Clone GM14426 Report

Search the DGRC for GM14426

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:144
Well:26
Vector:pOT2
Associated Gene/Transcriptbigmax-RA
Protein status:GM14426.pep: gold
Preliminary Size:1166
Sequenced Size:978

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3350 2001-01-01 Release 2 assignment
CG3350 2002-05-20 Blastp of sequenced clone
CG3350 2003-01-01 Sim4 clustering to Release 3
bigmax 2008-04-29 Release 5.5 accounting
bigmax 2008-08-15 Release 5.9 accounting
bigmax 2008-12-18 5.12 accounting

Clone Sequence Records

GM14426.complete Sequence

978 bp (978 high quality bases) assembled on 2002-05-20

GenBank Submission: AY118474

> GM14426.complete
GGAATTCCAAAACGTCGCAGTTGACGATGAGCGATAATAACAACGCGTTG
GCCACCAAGGAAGACGTTTTCGGCATGGAGCACGACCAGGACCACACCAG
CAAGCACTACTCGCGGTGCAGCAGTGCGGGCAGCACGCACACTCCGAACT
CCTCGGCGCACAATTCAGACGACGACGACGATAGCGGCGATGCGCGCCAT
TCCGCGGCCGCCAATTCCACGCTGAGTTACAAGGAGCGGAGAAGGGAGGC
GCACACCCAGGCGGAGCAGAAGCGGCGCGATGCCATCAAGAAGGGCTACG
ACAGTCTGCAGGAGCTGGTGCCGCGCTGCCAGCCCAACGACTCCTCCGGC
TACAAGCTCAGCAAGGCTCTGATCCTGCAGAAGTCCATCGAATACATTGG
CTACCTTAACCAGCAGAAACTCAAGCAGGAGGACGAGGGATCGGCGCTAC
AGAAGGAGGTAACAGCGTTACGGATCATTAAGAACGGCTATGAGAACATG
CTACAGCATCAGCAGGCGAATCCAGGGCCGGAGGAGGCACGCCTCACCGA
TGAGGCCAAGTTTCAAGTGTTCCAGGCAATTATGGAGGAAATGTTCGAGA
CATTTCAACACATACCCATGGAGAACTTTAAGCAGCTGACCACCGGCATT
ATCCCCTGGCTGGAGGAGCACTGCAAGCCGCACATCCTGCGCAACATACT
CAGTCGTACCTTGCAGCAAATGGCGCAGGAGGCTATGGAAAAACAGGAAC
TTCAGGCCATGGAGCAGGAGTCGAGCGAGGGTTTCAGCTGATCGCGCGGT
TAGTTCATATTCTCATTGGTTATTTTAGAAATCCCTGTTTGGTAGATACT
TTCGTTACGTTTACTGCGTACAAACATTAAATGCGTCATTTGAATAGTTG
TAAAAGCGTTGACAAGGAAAGATAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

GM14426.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
bigmax-RA 1118 bigmax-RA 152..1076 1..925 4565 99.5 Plus
bigmax.b 918 bigmax.b 1..918 1..924 4445 98.9 Plus
bigmax.a 876 bigmax.a 1..458 1..458 2260 99.5 Plus
bigmax.a 876 bigmax.a 457..876 505..924 2070 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23110709..23111112 569..166 2020 100 Minus
chr3R 27901430 chr3R 23110290..23110644 923..569 1775 100 Minus
chr3R 27901430 chr3R 23111252..23111419 168..1 840 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:23:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27287785..27288188 569..166 1975 99.3 Minus
3R 32079331 3R 27287364..27287720 925..569 1770 99.7 Minus
3R 32079331 3R 27288328..27288495 168..1 840 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:31:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27028616..27029019 569..166 1975 99.2 Minus
3R 31820162 3R 27028195..27028551 925..569 1770 99.7 Minus
3R 31820162 3R 27029159..27029326 168..1 840 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:54:36 has no hits.

GM14426.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:55:16 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23110290..23110643 570..923 100 <- Minus
chr3R 23110709..23111109 169..569 100 <- Minus
chr3R 23111252..23111419 1..168 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:08:48 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 1..765 27..791 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:38:56 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 1..765 27..791 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:28:37 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 1..765 27..791 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:30:43 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 1..765 27..791 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:25:37 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 1..765 27..791 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:12:00 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 1..923 1..923 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:38:56 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 1..923 1..923 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:28:37 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 32..954 1..923 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:30:43 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 1..923 1..923 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:25:37 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
bigmax-RA 32..954 1..923 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:55:16 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27287366..27287719 570..923 99 <- Minus
3R 27287785..27288185 169..569 99 <- Minus
3R 27288328..27288495 1..168 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:55:16 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27287366..27287719 570..923 99 <- Minus
3R 27287785..27288185 169..569 99 <- Minus
3R 27288328..27288495 1..168 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:55:16 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27287366..27287719 570..923 99 <- Minus
3R 27287785..27288185 169..569 99 <- Minus
3R 27288328..27288495 1..168 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:28:37 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23113088..23113441 570..923 99 <- Minus
arm_3R 23113507..23113907 169..569 99 <- Minus
arm_3R 23114050..23114217 1..168 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:03:15 Download gff for GM14426.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27028197..27028550 570..923 99 <- Minus
3R 27028616..27029016 169..569 99 <- Minus
3R 27029159..27029326 1..168 100   Minus

GM14426.hyp Sequence

Translation from 2 to 790

> GM14426.hyp
NSKTSQLTMSDNNNALATKEDVFGMEHDQDHTSKHYSRCSSAGSTHTPNS
SAHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYD
SLQELVPRCQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQ
KEVTALRIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFET
FQHIPMENFKQLTTGIIPWLEEHCKPHILRNILSRTLQQMAQEAMEKQEL
QAMEQESSEGFS*

GM14426.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
bigmax-PA 254 CG3350-PA 1..254 9..262 1318 100 Plus
Mio-PE 925 CG18362-PE 690..891 47..241 173 26.9 Plus
Mio-PM 1119 CG18362-PM 884..1085 47..241 173 26.9 Plus
Mio-PL 1119 CG18362-PL 884..1085 47..241 173 26.9 Plus
Mio-PK 1119 CG18362-PK 884..1085 47..241 173 26.9 Plus

GM14426.pep Sequence

Translation from 26 to 790

> GM14426.pep
MSDNNNALATKEDVFGMEHDQDHTSKHYSRCSSAGSTHTPNSSAHNSDDD
DDSGDARHSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYDSLQELVPR
CQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRI
IKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETFQHIPMEN
FKQLTTGIIPWLEEHCKPHILRNILSRTLQQMAQEAMEKQELQAMEQESS
EGFS*

GM14426.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18714-PA 254 GF18714-PA 1..254 1..254 1109 90.2 Plus
Dana\GF15566-PA 1160 GF15566-PA 940..1127 61..233 179 28.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12119-PA 254 GG12119-PA 1..254 1..254 1337 96.5 Plus
Dere\GG21509-PA 1071 GG21509-PA 863..1037 71..233 168 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23834-PA 263 GH23834-PA 1..234 1..235 1095 86.1 Plus
Dgri\GH13021-PA 1238 GH13021-PA 1011..1204 55..233 177 27.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
bigmax-PA 254 CG3350-PA 1..254 1..254 1318 100 Plus
Mondo-PE 925 CG18362-PE 690..891 39..233 173 26.9 Plus
Mondo-PM 1119 CG18362-PM 884..1085 39..233 173 26.9 Plus
Mondo-PL 1119 CG18362-PL 884..1085 39..233 173 26.9 Plus
Mondo-PK 1119 CG18362-PK 884..1085 39..233 173 26.9 Plus
Mondo-PJ 1119 CG18362-PJ 884..1085 39..233 173 26.9 Plus
Mondo-PI 1119 CG18362-PI 884..1085 39..233 173 26.9 Plus
Mondo-PH 1119 CG18362-PH 884..1085 39..233 173 26.9 Plus
Mondo-PG 1119 CG18362-PG 884..1085 39..233 173 26.9 Plus
Mondo-PF 1119 CG18362-PF 884..1085 39..233 173 26.9 Plus
Mondo-PA 1119 CG18362-PA 884..1085 39..233 173 26.9 Plus
Mondo-PB 1119 CG18362-PB 884..1085 39..233 173 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24571-PA 254 GI24571-PA 1..254 1..254 1064 83.3 Plus
Dmoj\GI17432-PA 1075 GI17432-PA 840..1041 39..233 182 27.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23593-PA 251 GL23593-PA 1..251 1..254 1158 89.4 Plus
Dper\GL26357-PA 1125 GL26357-PA 879..1091 27..233 169 27.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17397-PA 251 GA17397-PA 1..251 1..254 1158 89.4 Plus
Dpse\GA14905-PA 1110 GA14905-PA 864..1076 27..233 167 27.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10111-PA 254 GM10111-PA 1..254 1..254 1343 98 Plus
Dsec\GM23262-PA 1116 GM23262-PA 881..1082 39..233 169 26.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15127-PA 386 GD15127-PA 1..187 1..187 990 98.4 Plus
Dsim\GD21641-PA 451 GD21641-PA 204..417 27..233 175 26.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22637-PA 252 GJ22637-PA 1..252 1..254 1099 84.8 Plus
Dvir\GJ18379-PA 1181 GJ18379-PA 951..1147 52..233 182 28.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11114-PA 246 GK11114-PA 1..224 1..233 1000 87.1 Plus
Dwil\GK18680-PA 1168 GK18680-PA 940..1134 52..233 177 29.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10568-PA 254 GE10568-PA 1..254 1..254 1338 96.9 Plus
Dyak\GE12990-PA 1071 GE12990-PA 836..1037 39..233 175 28.3 Plus