Clone GM14452 Report

Search the DGRC for GM14452

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:144
Well:52
Vector:pOT2
Associated Gene/TranscriptCoIV-RA
Protein status:GM14452.pep: gold
Preliminary Size:693
Sequenced Size:713

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10664 2001-01-01 Release 2 assignment
CG10664 2001-09-19 Blastp of sequenced clone
CG10664 2003-01-01 Sim4 clustering to Release 3
CG10664 2008-04-29 Release 5.5 accounting
CG10664 2008-08-15 Release 5.9 accounting
CG10664 2008-12-18 5.12 accounting

Clone Sequence Records

GM14452.complete Sequence

713 bp (713 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058491

> GM14452.complete
AGCAAGTCTAAGAAAAACTCTGTGAGAAAATGGCCCTGCGACTACTCAAC
AGTGCTGTGCTCCGCCAGCTGGCCTCTCAGCTGCCCAAGAGTGCCCAGGT
GGGCAGCGTGGCCGCCGTCCACACACTGGACAAGATCGGCAAGCGGGAGA
TCGTTGGCTACGGCTGGAACGGCACCGCCTGCTACGCGGATCGCGTGGAC
TACCCTCTGCCCGCCGTGCGCTTCCGTGAGCCCACCAACGAGATCAACGC
TCTGCGCGCCAAGGAGCAGGGAGACTGGAAGAAGCTCAGCACCCAGGAGA
TCAAGGCCCTGTACCGCGCCAGCTTCTGCCAGACTATCGCCGAGGTCCAG
GCTGGATCCGGGGAGTGGAAGCTCCACCTGGGCGTTTCACTCCTCTTCTG
CGCCGCCGCCATCTGGGTGGCCGTACTGATGAACATCTTCGTGTACGATG
AGCTGCCCGTTACCTTCGACGAGGAGCACCAGAAGGCGCAGCTGCAGCGC
ATCATCGACCTGGAAATCAACCCCGTCACCGGATTGACCTCCAAGTGGGA
CTACGAGAACAAGAAGTGGAAGAACTAAGTGCGCTGTCGTTAAATAATTC
CGCGATTGTGTGTGATTAAGTTAGCCGACGTCTATGTGTATTAAGTAAAA
GCAAGATAGTCGAAATTAAAGTTATGGCTGCTGCCTAAAACAATCAAAAA
AAAAAAAAAAAAA

GM14452.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG10664-RA 908 CG10664-RA 61..755 1..695 3445 99.7 Plus
CG10664-RB 809 CG10664-RB 50..748 1..695 3380 99.1 Plus
CG10664.a 809 CG10664.a 70..748 17..695 3365 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19957607..19958031 17..441 2125 100 Plus
chr2L 23010047 chr2L 19958090..19958344 441..695 1245 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:23:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19959267..19959691 17..441 2125 100 Plus
2L 23513712 2L 19959750..19960004 441..695 1245 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19959267..19959691 17..441 2125 100 Plus
2L 23513712 2L 19959750..19960004 441..695 1245 99.2 Plus
Blast to na_te.dros performed on 2019-03-16 23:25:56 has no hits.

GM14452.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:26:58 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19957089..19957104 1..16 100 -> Plus
chr2L 19957607..19958031 17..441 100 -> Plus
chr2L 19958091..19958344 442..695 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:08:49 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
CG10664-RB 1..549 30..578 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:40:55 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
CG10664-RB 1..549 30..578 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:04 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
CoIV-RB 1..549 30..578 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:19:10 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
CG10664-RB 1..549 30..578 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:49:53 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
CoIV-RB 1..549 30..578 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:46:41 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
CG10664-RA 38..732 1..695 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:40:55 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
CG10664-RA 38..732 1..695 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:04 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
CoIV-RA 37..731 1..695 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:19:10 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
CG10664-RA 38..732 1..695 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:49:53 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
CoIV-RA 37..731 1..695 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:58 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19959751..19960004 442..695 99   Plus
2L 19958749..19958764 1..16 100 -> Plus
2L 19959267..19959691 17..441 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:58 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19959751..19960004 442..695 99   Plus
2L 19958749..19958764 1..16 100 -> Plus
2L 19959267..19959691 17..441 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:58 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19959751..19960004 442..695 99   Plus
2L 19958749..19958764 1..16 100 -> Plus
2L 19959267..19959691 17..441 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:04 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19958749..19958764 1..16 100 -> Plus
arm_2L 19959267..19959691 17..441 100 -> Plus
arm_2L 19959751..19960004 442..695 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:54:05 Download gff for GM14452.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19959267..19959691 17..441 100 -> Plus
2L 19959751..19960004 442..695 99   Plus
2L 19958749..19958764 1..16 100 -> Plus

GM14452.pep Sequence

Translation from 29 to 577

> GM14452.pep
MALRLLNSAVLRQLASQLPKSAQVGSVAAVHTLDKIGKREIVGYGWNGTA
CYADRVDYPLPAVRFREPTNEINALRAKEQGDWKKLSTQEIKALYRASFC
QTIAEVQAGSGEWKLHLGVSLLFCAAAIWVAVLMNIFVYDELPVTFDEEH
QKAQLQRIIDLEINPVTGLTSKWDYENKKWKN*

GM14452.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14440-PA 182 GF14440-PA 1..182 1..182 892 90.1 Plus
Dana\GF19202-PA 180 GF19202-PA 3..180 2..181 410 47.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21213-PA 182 GG21213-PA 1..182 1..182 949 97.8 Plus
Dere\GG14869-PA 176 GG14869-PA 31..176 36..181 425 55.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13835-PA 182 GH13835-PA 1..182 1..182 878 87.4 Plus
Dgri\GH24897-PA 183 GH24897-PA 39..183 37..181 403 56.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
COX4-PD 182 CG10664-PD 1..182 1..182 949 100 Plus
COX4-PC 182 CG10664-PC 1..182 1..182 949 100 Plus
COX4-PB 182 CG10664-PB 1..182 1..182 949 100 Plus
COX4-PA 182 CG10664-PA 1..182 1..182 949 100 Plus
COX4L-PB 162 CG10396-PB 17..162 36..181 391 51.4 Plus
COX4L-PA 176 CG10396-PA 31..176 36..181 391 51.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20302-PA 182 GI20302-PA 1..182 1..182 874 85.7 Plus
Dmoj\GI15072-PA 198 GI15072-PA 54..198 37..181 474 57.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26331-PA 182 GL26331-PA 1..182 1..182 897 88.5 Plus
Dper\GL12448-PA 187 GL12448-PA 3..187 2..181 396 43.2 Plus
Dper\GL22539-PA 180 GL22539-PA 3..179 2..173 374 42.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10478-PA 182 GA10478-PA 1..182 1..182 897 88.5 Plus
Dpse\GA27506-PA 187 GA27506-PA 43..187 37..181 393 49.7 Plus
Dpse\GA27921-PA 185 GA27921-PA 48..184 37..173 369 48.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17383-PA 182 GM17383-PA 1..182 1..182 952 97.3 Plus
Dsec\GM11103-PA 176 GM11103-PA 31..176 36..181 395 51.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CoIV-PA 182 GD24236-PA 1..182 1..182 952 97.3 Plus
Dsim\GD10371-PA 176 GD10371-PA 31..176 36..181 390 51.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13654-PA 182 GJ13654-PA 1..182 1..182 878 85.7 Plus
Dvir\GJ18878-PA 191 GJ18878-PA 48..191 37..181 438 57.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14931-PA 182 GK14931-PA 1..182 1..182 883 87.9 Plus
Dwil\GK19830-PA 189 GK19830-PA 2..189 1..181 420 46.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13288-PA 182 GE13288-PA 1..182 1..182 951 98.4 Plus
Dyak\GE15061-PA 176 GE15061-PA 31..176 36..181 395 50 Plus
Dyak\GE14691-PA 202 GE14691-PA 17..156 36..179 351 47.2 Plus

GM14452.hyp Sequence

Translation from 29 to 577

> GM14452.hyp
MALRLLNSAVLRQLASQLPKSAQVGSVAAVHTLDKIGKREIVGYGWNGTA
CYADRVDYPLPAVRFREPTNEINALRAKEQGDWKKLSTQEIKALYRASFC
QTIAEVQAGSGEWKLHLGVSLLFCAAAIWVAVLMNIFVYDELPVTFDEEH
QKAQLQRIIDLEINPVTGLTSKWDYENKKWKN*

GM14452.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
CoIV-PD 182 CG10664-PD 1..182 1..182 949 100 Plus
CoIV-PC 182 CG10664-PC 1..182 1..182 949 100 Plus
CoIV-PB 182 CG10664-PB 1..182 1..182 949 100 Plus
CoIV-PA 182 CG10664-PA 1..182 1..182 949 100 Plus
CG10396-PB 162 CG10396-PB 17..162 36..181 391 51.4 Plus