Clone GM14478 Report

Search the DGRC for GM14478

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:144
Well:78
Vector:pOT2
Associated Gene/TranscriptRpI12-RA
Protein status:GM14478.pep: gold
Preliminary Size:703
Sequenced Size:521

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpI12 2008-12-18 5.12 accounting

Clone Sequence Records

GM14478.complete Sequence

521 bp assembled on 2008-12-08

GenBank Submission: BT050591.1

> GM14478.complete
TTTTGATTTTGGGTGATATATACTGGCATGGATATTTTTTCCAATTGTCC
GGGCTTTTGCCCCTCCTGCGGCTCCATTCTGCCCGAGCTTCAAGTCAAGG
GCAATGTGATTTGCTACAACTGCAAGAAGGAGTTTCAGCCAGATGTTTAC
AGCGGCGAGAAGTCCGAGTTTACCATACACTTCAACACCTACGATCCCAG
CAAGGTGTTCAACAGGACGAAAAGGGAGTCGGAATCGGACGCGGATGGCC
CCGTTGTGGAGAGGAAGTGTCCCAAGTGCAACCACGACAAGATGTCCTAT
GCCACCCTGCAGCTTCGATCGGCGGACGAAGGCCAGACGGTGTTCTTTAC
CTGCCTTAAGTGCAAATTCAAAGAATCCGAAAACTCTTAGTTGCTAGCAA
TGTCCGTGTAAATAGTCCTAGATTAATGAAAATAATCATGCTCGACGGCC
TGAGAAATATAGAATTTACCAATTATAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

GM14478.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
RpI12-RA 987 RpI12-RA 66..543 1..478 2390 100 Plus
CG6800.a 1100 CG6800.a 1030..1100 451..381 355 100 Minus
CG6800.c 1100 CG6800.c 1030..1100 451..381 355 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17601132..17601352 365..145 1105 100 Minus
chr3R 27901430 chr3R 17601403..17601547 145..1 725 100 Minus
chr3R 27901430 chr3R 17600957..17601072 476..361 565 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:23:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21777378..21777598 365..145 1105 100 Minus
3R 32079331 3R 21777649..21777793 145..1 725 100 Minus
3R 32079331 3R 21777201..21777318 478..361 575 99.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21518209..21518429 365..145 1105 100 Minus
3R 31820162 3R 21518480..21518624 145..1 725 100 Minus
3R 31820162 3R 21518032..21518149 478..361 575 99.1 Minus
Blast to na_te.dros performed on 2019-03-16 02:53:45 has no hits.

GM14478.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:54:34 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17600957..17601067 366..476 100 <- Minus
chr3R 17601132..17601351 146..365 100 <- Minus
chr3R 17601403..17601547 1..145 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:59:47 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
RpI12-RA 1..363 28..390 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:18 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
RpI12-RA 1..363 28..390 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:46 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
RpI12-RA 1..363 28..390 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:08 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
RpI12-RA 1..363 28..390 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-08 16:14:00 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
RpI12-RA 1..471 6..476 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:18 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
RpI12-RA 1..471 6..476 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:46 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
RpI12-RA 55..530 1..476 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:08 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
RpI12-RA 55..530 1..476 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:34 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21777203..21777313 366..476 100 <- Minus
3R 21777378..21777597 146..365 100 <- Minus
3R 21777649..21777793 1..145 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:34 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21777203..21777313 366..476 100 <- Minus
3R 21777378..21777597 146..365 100 <- Minus
3R 21777649..21777793 1..145 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:34 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21777203..21777313 366..476 100 <- Minus
3R 21777378..21777597 146..365 100 <- Minus
3R 21777649..21777793 1..145 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:46 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17602925..17603035 366..476 100 <- Minus
arm_3R 17603100..17603319 146..365 100 <- Minus
arm_3R 17603371..17603515 1..145 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:52:55 Download gff for GM14478.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21518480..21518624 1..145 100   Minus
3R 21518209..21518428 146..365 100 <- Minus
3R 21518034..21518144 366..476 100 <- Minus

GM14478.pep Sequence

Translation from 27 to 389

> GM14478.pep
MDIFSNCPGFCPSCGSILPELQVKGNVICYNCKKEFQPDVYSGEKSEFTI
HFNTYDPSKVFNRTKRESESDADGPVVERKCPKCNHDKMSYATLQLRSAD
EGQTVFFTCLKCKFKESENS*

GM14478.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17465-PA 121 GF17465-PA 1..121 1..120 573 90.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22692-PA 120 GG22692-PA 1..120 1..120 610 95 Plus
Dere\GG11044-PA 120 GG11044-PA 1..120 1..120 610 95 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16255-PA 120 GH16255-PA 1..120 1..120 517 80 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
RpI12-PA 120 CG13418-PA 1..120 1..120 662 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22183-PA 121 GI22183-PA 1..121 1..120 502 77.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23744-PA 121 GL23744-PA 1..121 1..120 553 86 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12270-PA 121 GA12270-PA 1..121 1..120 553 86 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23695-PA 120 GM23695-PA 1..120 1..120 621 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18505-PA 120 GD18505-PA 1..120 1..120 615 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24301-PA 121 GJ24301-PA 1..121 1..120 516 80.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13021-PA 121 GK13021-PA 1..121 1..120 558 87.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24089-PA 120 GE24089-PA 1..120 1..120 616 96.7 Plus

GM14478.hyp Sequence

Translation from 27 to 389

> GM14478.hyp
MDIFSNCPGFCPSCGSILPELQVKGNVICYNCKKEFQPDVYSGEKSEFTI
HFNTYDPSKVFNRTKRESESDADGPVVERKCPKCNHDKMSYATLQLRSAD
EGQTVFFTCLKCKFKESENS*

GM14478.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
RpI12-PA 120 CG13418-PA 1..120 1..120 662 100 Plus