Clone GM14501 Report

Search the DGRC for GM14501

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:145
Well:1
Vector:pOT2
Associated Gene/TranscriptCG4769-RA
Protein status:GM14501.pep: gold
Preliminary Size:1300
Sequenced Size:1163

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4769 2001-01-01 Release 2 assignment
CG4769 2002-03-19 Blastp of sequenced clone
CG4769 2003-01-01 Sim4 clustering to Release 3
CG4769 2008-04-29 Release 5.5 accounting
CG4769 2008-08-15 Release 5.9 accounting
CG4769 2008-12-18 5.12 accounting

Clone Sequence Records

GM14501.complete Sequence

1163 bp (1163 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094773

> GM14501.complete
CGAGAGAGCAGCGAAGAAGAGGAAGACGTTGTGGCAGTGGTACTGAAAGA
TTGATTCGATTGGCGATTGGCTGCCCGCAGAGTTTCCTTAAACGACCAGA
CGACGCAGAAATTAAAACTCCGGCCACCATGGCAGCGACATTGCGAAGAT
TCCATGGCTTGAGATTGCTGAAATCCGCGCCAGCACTCAGCCTGCAGCAG
GCGAAGAACCTCTCTTCCGCCGGCAGCTGGGCCAGTGGCAACAAGAAGCT
GATCGGCGCCTTGGGAGCAATCACCGGCGGAGTGGGCGCCCTTATCTACG
CCCTGGAGCAGTCCGTGCAGGCATCTGGCGGCGAGGTGCACTCCCCCGCG
CAACTCTGGAACCACAAGGGCCTCTTCGACGCTTTGGACCACCAGAGCGT
TCGTCGCGGCTACGAGGTGTACAAGCAGGTGTGCTCCGCCTGCCACTCGA
TGCAATACATTGCCTACCGCAATCTGGTTGGTGTCACCCACACCGAAGCC
GAGGCCAAGGCTGAAGCCGAGCAGATCACGGTCAAGGACGGTCCCGATGA
CACCGGCAACTACTACACTCGTCCTGGCAAGCTGTCGGACTACTTCCCAT
CGCCGTATCCCAACGAGGAAGCGGCCCGTGCTGCCAACAACGGTGCTTAT
CCTCCGGATCTGAGCTACATCGTGTCGGCCCGCAAGGGCGGAGAGGATTA
CATCTTCTCGCTGCTCACGGGCTACCATGATGCTCCTGCCGGAGTGGTGC
TGCGCGAGGGTCAGTACTTCAACCCGTACTTCCCGGGCGGTGCCATTTCC
ATGGCCCAGGTGTTGTACAACGAGGTCATCGAGTACGAGGACGGCACACC
GCCGACGCAGAGCCAGCTGGCCAAGGACGTGGCCACTTTCCTGAAGTGGA
CTTCCGAGCCGGAGCACGACGATCGCAAGCAGCTGCTGATCAAGGTGATT
GGCATCCTTGGCTTCCTGACCGTCATCTCGTATTACATTAAGCGGCACAA
GTGGTCGTCGCTCAAGTCGCGGAAGATTGTGTTCGTGCCCAAGGAGAAGT
AGAATGTTTGAATTTGATTTTGATGGTGTGAAGAAATGCAGTGTTATCGC
GGCTTTACCGACTAATAAAGATAAATCAATTTTAAGCAAAAACCAAAAAA
AAAAAAAAAAAAA

GM14501.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG4769-RA 1759 CG4769-RA 94..1241 1..1148 5650 99.4 Plus
CG4769.a 1445 CG4769.a 76..977 247..1148 4435 99.4 Plus
CG14508-RA 1461 CG14508-RA 715..956 570..811 490 80.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5354672..5354993 823..1144 1610 100 Plus
chr3L 24539361 chr3L 5354265..5354561 530..826 1425 98.7 Plus
chr3L 24539361 chr3L 5352783..5352983 1..201 1005 100 Plus
chr3L 24539361 chr3L 5353446..5353596 247..397 740 99.3 Plus
chr3L 24539361 chr3L 5354062..5354198 396..532 670 99.3 Plus
chr3R 27901430 chr3R 25025845..25026300 811..356 660 76.3 Minus
chr3L 24539361 chr3L 5353259..5353310 197..248 260 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:23:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5362101..5362426 823..1148 1630 100 Plus
3L 28110227 3L 5361694..5361990 530..826 1425 98.7 Plus
3L 28110227 3L 5360212..5360412 1..201 1005 100 Plus
3L 28110227 3L 5360875..5361025 247..397 755 100 Plus
3L 28110227 3L 5361491..5361627 396..532 670 99.3 Plus
3R 32079331 3R 29203044..29203499 811..356 660 76.3 Minus
3L 28110227 3L 5360688..5360739 197..248 245 98.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5355201..5355526 823..1148 1630 100 Plus
3L 28103327 3L 5354794..5355090 530..826 1425 98.6 Plus
3L 28103327 3L 5353312..5353512 1..201 1005 100 Plus
3L 28103327 3L 5353975..5354125 247..397 755 100 Plus
3L 28103327 3L 5354591..5354727 396..532 670 99.2 Plus
3R 31820162 3R 28943875..28944116 811..570 490 80.1 Minus
3L 28103327 3L 5353788..5353839 197..248 245 98 Plus
Blast to na_te.dros performed 2019-03-16 23:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 4184..4248 251..320 114 65.7 Plus

GM14501.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:27:13 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5353448..5353596 249..397 99 -> Plus
chr3L 5354064..5354196 398..530 99 -> Plus
chr3L 5352783..5352982 1..200 100 -> Plus
chr3L 5353263..5353310 201..248 100 -> Plus
chr3L 5354266..5354559 531..824 98 -> Plus
chr3L 5354674..5354993 825..1144 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:08:55 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
CG4769-RA 1..924 129..1052 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:05 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
CG4769-RA 1..924 129..1052 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:36 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
CG4769-RA 1..924 129..1052 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:36 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
CG4769-RA 1..924 129..1052 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:50:20 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
CG4769-RA 1..924 129..1052 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:06:42 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
CG4769-RA 23..1166 1..1144 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:05 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
CG4769-RA 23..1166 1..1144 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:36 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
CG4769-RA 2..1145 1..1144 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:36 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
CG4769-RA 23..1166 1..1144 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:50:20 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
CG4769-RA 2..1145 1..1144 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:27:13 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5360212..5360411 1..200 100 -> Plus
3L 5360692..5360739 201..248 97 -> Plus
3L 5360877..5361025 249..397 100 -> Plus
3L 5361493..5361625 398..530 99 -> Plus
3L 5361695..5361988 531..824 98 -> Plus
3L 5362103..5362422 825..1144 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:27:13 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5360212..5360411 1..200 100 -> Plus
3L 5360692..5360739 201..248 97 -> Plus
3L 5360877..5361025 249..397 100 -> Plus
3L 5361493..5361625 398..530 99 -> Plus
3L 5361695..5361988 531..824 98 -> Plus
3L 5362103..5362422 825..1144 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:27:13 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5360212..5360411 1..200 100 -> Plus
3L 5360692..5360739 201..248 97 -> Plus
3L 5360877..5361025 249..397 100 -> Plus
3L 5361493..5361625 398..530 99 -> Plus
3L 5361695..5361988 531..824 98 -> Plus
3L 5362103..5362422 825..1144 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:36 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5353312..5353511 1..200 100 -> Plus
arm_3L 5353792..5353839 201..248 97 -> Plus
arm_3L 5353977..5354125 249..397 100 -> Plus
arm_3L 5354593..5354725 398..530 99 -> Plus
arm_3L 5354795..5355088 531..824 98 -> Plus
arm_3L 5355203..5355522 825..1144 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:16 Download gff for GM14501.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5354795..5355088 531..824 98 -> Plus
3L 5355203..5355522 825..1144 100   Plus
3L 5353312..5353511 1..200 100 -> Plus
3L 5353792..5353839 201..248 97 -> Plus
3L 5353977..5354125 249..397 100 -> Plus
3L 5354593..5354725 398..530 99 -> Plus

GM14501.hyp Sequence

Translation from 2 to 1051

> GM14501.hyp
REQRRRGRRCGSGTERLIRLAIGCPQSFLKRPDDAEIKTPATMAATLRRF
HGLRLLKSAPALSLQQAKNLSSAGSWASGNKKLIGALGAITGGVGALIYA
LEQSVQASGGEVHSPAQLWNHKGLFDALDHQSVRRGYEVYKQVCSACHSM
QYIAYRNLVGVTHTEAEAKAEAEQITVKDGPDDTGNYYTRPGKLSDYFPS
PYPNEEAARAANNGAYPPDLSYIVSARKGGEDYIFSLLTGYHDAPAGVVL
REGQYFNPYFPGGAISMAQVLYNEVIEYEDGTPPTQSQLAKDVATFLKWT
SEPEHDDRKQLLIKVIGILGFLTVISYYIKRHKWSSLKSRKIVFVPKEK*

GM14501.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG4769-PB 307 CG4769-PB 1..307 43..349 1605 100 Plus
CG4769-PA 307 CG4769-PA 1..307 43..349 1605 100 Plus
CG14508-PA 344 CG14508-PA 35..309 74..347 1010 70.5 Plus

GM14501.pep Sequence

Translation from 128 to 1051

> GM14501.pep
MAATLRRFHGLRLLKSAPALSLQQAKNLSSAGSWASGNKKLIGALGAITG
GVGALIYALEQSVQASGGEVHSPAQLWNHKGLFDALDHQSVRRGYEVYKQ
VCSACHSMQYIAYRNLVGVTHTEAEAKAEAEQITVKDGPDDTGNYYTRPG
KLSDYFPSPYPNEEAARAANNGAYPPDLSYIVSARKGGEDYIFSLLTGYH
DAPAGVVLREGQYFNPYFPGGAISMAQVLYNEVIEYEDGTPPTQSQLAKD
VATFLKWTSEPEHDDRKQLLIKVIGILGFLTVISYYIKRHKWSSLKSRKI
VFVPKEK*

GM14501.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23975-PA 307 GF23975-PA 1..307 1..307 1515 94.1 Plus
Dana\GF18408-PA 343 GF18408-PA 35..308 33..305 1034 69 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15267-PA 307 GG15267-PA 1..307 1..307 1619 98.7 Plus
Dere\GG12029-PA 344 GG12029-PA 31..309 28..305 995 69.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16186-PA 307 GH16186-PA 1..307 1..307 1451 89.6 Plus
Dgri\GH14006-PA 335 GH14006-PA 1..309 1..305 930 61.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c1-PB 307 CG4769-PB 1..307 1..307 1605 100 Plus
Cyt-c1-PA 307 CG4769-PA 1..307 1..307 1605 100 Plus
Cyt-c1L-PA 344 CG14508-PA 35..309 32..305 1010 70.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13337-PA 307 GI13337-PA 1..307 1..307 1479 91.2 Plus
Dmoj\GI22350-PA 323 GI22350-PA 1..308 1..305 943 61.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12203-PA 356 GL12203-PA 1..270 1..270 1265 92.2 Plus
Dper\GL13606-PA 354 GL13606-PA 13..307 11..305 1049 67.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18418-PA 307 GA18418-PA 1..307 1..307 1445 92.2 Plus
Dpse\GA13039-PA 354 GA13039-PA 13..307 11..305 1049 67.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14701-PA 307 GM14701-PA 1..307 1..307 1638 100 Plus
Dsec\GM12253-PA 344 GM12253-PA 35..309 32..305 1004 70.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13884-PA 307 GD13884-PA 1..307 1..307 1638 100 Plus
Dsim\GD17917-PA 344 GD17917-PA 24..309 21..305 999 68.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13163-PA 307 GJ13163-PA 1..307 1..307 1479 91.5 Plus
Dvir\GJ14231-PA 324 GJ14231-PA 1..307 1..305 981 61.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16868-PA 307 GK16868-PA 1..307 1..307 1501 93.2 Plus
Dwil\GK22494-PA 321 GK22494-PA 4..301 12..304 1003 64.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21489-PA 307 GE21489-PA 1..307 1..307 1622 99 Plus
Dyak\GE10466-PA 344 GE10466-PA 39..309 36..305 992 70.5 Plus