Clone GM14585 Report

Search the DGRC for GM14585

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:145
Well:85
Vector:pOT2
Associated Gene/TranscriptRpS23-RA
Protein status:GM14585.pep: gold
Preliminary Size:830
Sequenced Size:630

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8415 2001-01-01 Release 2 assignment
CG8415 2002-02-26 Blastp of sequenced clone
RpS23 2008-04-29 Release 5.5 accounting
RpS23 2008-08-15 Release 5.9 accounting
RpS23 2008-12-18 5.12 accounting

Clone Sequence Records

GM14585.complete Sequence

630 bp (630 high quality bases) assembled on 2002-02-26

GenBank Submission: AY089523

> GM14585.complete
TAACGCTCAGCAACGGTCACTCTGCCATCCTTCTTTTTATTTCCGCCGTT
TGCCGAGAAAGTTGGAAAATTATGGGCAAGCCAAGAGGTCTGCGCACTGC
CAGGAAGCATGTGAACCACCGTCGCGACCAGCGTTGGGCCGACAAGGACT
ACAAGAAGGCTCATTTGGGCACCAGATGGAAGGCTAATCCCTTCGGAGGT
GCTTCCCACGCCAAGGGAATCGTCCTGGAGAAGGTCGGCGTCGAGGCCAA
GCAGCCTAACTCTGCCATCCGCAAGTGCGTGAGGGTGCAGCTCATCAAGA
ACGGCAAGAAGATCACCGCCTTCGTGCCCCGTGACGGTAGCTTGAACTAC
ATTGAGGAGAACGACGAGGTCCTGGTTGCCGGTTTCGGTCGTAAGGGTCA
TGCCGTCGGTGATATTCCCGGTGTGCGCTTCAAGGTTGTCAAGGTCGCCA
ACGTCTCCCTGTTGGCCCTCTACAAGGAGAAGAAGGAACGCCCAAGATCT
TAGATGAACATGCATCTAATCTTTTTCCAGACAAGCAGAGTTAGGGTTTT
ACAAATCTAAATAAACAAAAAACAGAAACAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GM14585.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
RpS23-RA 946 RpS23-RA 105..686 1..582 2910 100 Plus
RpS23.a 1148 RpS23.a 307..888 1..582 2910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10102665..10103008 579..236 1720 100 Minus
chr2R 21145070 chr2R 10103257..10103417 235..75 805 100 Minus
chr2R 21145070 chr2R 10103839..10103914 76..1 380 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:23:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14215356..14215702 582..236 1735 100 Minus
2R 25286936 2R 14215951..14216111 235..75 805 100 Minus
2R 25286936 2R 14216529..14216604 76..1 380 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14216555..14216901 582..236 1735 100 Minus
2R 25260384 2R 14217150..14217310 235..75 805 100 Minus
2R 25260384 2R 14217728..14217803 76..1 380 100 Minus
2L 23513712 2L 22348182..22348231 558..607 190 92 Plus
Blast to na_te.dros performed on 2019-03-16 19:40:02 has no hits.

GM14585.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:40:43 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10102686..10103008 236..558 100 <- Minus
chr2R 10103257..10103416 76..235 100 <- Minus
chr2R 10103840..10103914 1..75 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:03 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
RpS23-RA 1..432 72..503 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:20 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
RpS23-RA 1..432 72..503 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:50 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
RpS23-RB 1..432 72..503 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:51 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
RpS23-RA 1..432 72..503 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:38:36 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
RpS23-RB 1..432 72..503 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:07 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
RpS23-RA 24..581 1..558 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:20 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
RpS23-RA 24..581 1..558 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:50 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
RpS23-RA 24..581 1..558 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:51 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
RpS23-RA 24..581 1..558 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:38:36 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
RpS23-RA 24..581 1..558 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:43 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14215380..14215702 236..558 100 <- Minus
2R 14215951..14216110 76..235 100 <- Minus
2R 14216530..14216604 1..75 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:43 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14215380..14215702 236..558 100 <- Minus
2R 14215951..14216110 76..235 100 <- Minus
2R 14216530..14216604 1..75 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:43 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14215380..14215702 236..558 100 <- Minus
2R 14215951..14216110 76..235 100 <- Minus
2R 14216530..14216604 1..75 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:50 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10102885..10103207 236..558 100 <- Minus
arm_2R 10103456..10103615 76..235 100 <- Minus
arm_2R 10104035..10104109 1..75 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:34 Download gff for GM14585.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14216579..14216901 236..558 100 <- Minus
2R 14217150..14217309 76..235 100 <- Minus
2R 14217729..14217803 1..75 100   Minus

GM14585.hyp Sequence

Translation from 2 to 502

> GM14585.hyp
TLSNGHSAILLFISAVCRESWKIMGKPRGLRTARKHVNHRRDQRWADKDY
KKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKN
GKKITAFVPRDGSLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVAN
VSLLALYKEKKERPRS*

GM14585.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
RpS23-PA 143 CG8415-PA 1..143 24..166 747 100 Plus
RpS23-PB 143 CG8415-PB 1..143 24..166 747 100 Plus
tko-PB 140 CG7925-PB 42..127 54..147 138 39.4 Plus
tko-PC 154 CG7925-PC 56..141 54..147 138 39.4 Plus

GM14585.pep Sequence

Translation from 71 to 502

> GM14585.pep
MGKPRGLRTARKHVNHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGI
VLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEV
LVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS*

GM14585.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12897-PA 143 GF12897-PA 1..143 1..143 742 100 Plus
Dana\GF21950-PA 140 GF21950-PA 42..127 31..124 136 40.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22436-PA 143 GG22436-PA 1..143 1..143 742 100 Plus
Dere\GG12613-PA 140 GG12613-PA 42..127 31..124 136 39.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20043-PA 143 GH20043-PA 1..143 1..143 742 100 Plus
Dgri\GH17581-PA 143 GH17581-PA 45..130 31..124 133 38.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
RpS23-PA 143 CG8415-PA 1..143 1..143 747 100 Plus
RpS23-PB 143 CG8415-PB 1..143 1..143 747 100 Plus
tko-PB 140 CG7925-PB 42..127 31..124 138 39.4 Plus
tko-PC 154 CG7925-PC 56..141 31..124 138 39.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20452-PA 143 GI20452-PA 1..143 1..143 742 100 Plus
Dmoj\GI15180-PA 141 GI15180-PA 43..128 31..124 138 39.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17287-PA 143 GL17287-PA 1..143 1..143 742 100 Plus
Dper\GL14306-PA 140 GL14306-PA 42..127 31..124 137 39.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21060-PA 143 GA21060-PA 1..143 1..143 742 100 Plus
Dpse\GA20693-PA 140 GA20693-PA 42..127 31..124 137 39.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20223-PA 143 GM20223-PA 1..143 1..143 742 100 Plus
Dsec\GM18879-PA 140 GM18879-PA 42..127 31..124 137 39.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25696-PA 143 GD25696-PA 1..143 1..143 742 100 Plus
Dsim\GD16364-PA 140 GD16364-PA 42..127 31..124 137 39.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22302-PA 143 GJ22302-PA 1..143 1..143 742 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21747-PA 143 GK21747-PA 1..143 1..143 742 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12328-PA 143 GE12328-PA 1..143 1..143 742 100 Plus
Dyak\GE16944-PA 140 GE16944-PA 42..127 31..124 137 39.4 Plus