Clone GM14633 Report

Search the DGRC for GM14633

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:146
Well:33
Vector:pOT2
Associated Gene/TranscriptCG6153-RA
Protein status:GM14633.pep: gold
Preliminary Size:1300
Sequenced Size:765

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6153 2001-01-01 Release 2 assignment
CG6153 2003-01-01 Sim4 clustering to Release 3
CG6153 2003-01-14 Blastp of sequenced clone
CG6153 2008-04-29 Release 5.5 accounting
CG6153 2008-08-15 Release 5.9 accounting
CG6153 2008-12-18 5.12 accounting

Clone Sequence Records

GM14633.complete Sequence

765 bp (765 high quality bases) assembled on 2003-01-14

GenBank Submission: AY060988

> GM14633.complete
CTCGGCTGCTTTATTTACATTGAATTTTTGTTCGATTTTTGAATTTAAAA
TAAAAATAATGCCGCACGGACACTCTCACGATCACGGCGGCTGCAGCCAC
GAGGCCTCGGACGTGGACCACGCCCTAGAAATGGGCATCGAGTACAGCTT
GTACACCAAAATCGATCTGGACAATGTGGAGTGCCTGAACGAGGAGACGG
ATGGCCAGGGAAAAAGTGTCTTTAAGCCGTACGAGAAGCGCCAGGATCTG
TCCAAGTACGTGGAGAGCGATGCGGATGAAGAGCTCCTCTTCAACATTCC
CTTCACCGGCAACATCAAGCTCAAGGGCATCATCATAAGTGGGGCCAATG
ATGACTCCCATCCAAACATGGTCAAAATCTTCAAGAACCGACCCAGGATG
ACCTTTGATGATGCCAGAGCAAAGCCCGACCAGGAGTTCCAGCTGACCCG
CGATGCCCGCGGAGAAATCGAGTACTCACCCAAAGTGGTCACCTTCTCCT
CCGTGCACCATCTCTCCCTCTACTTTCCCAGCAATTTTGGCGAAGACATA
ACACGCATTTACTATATAGGTCTTCGAGGAGAGTTCACAGAAGCTCATTA
CCATGGCGTAACCATATGCAACTACGAATCCCGTGCCAATGCAGCGGATC
ACAAGGAAAAGGCTTTCGATGGAGTCGGCAGAGCCATCCAATAGGGTTAT
AGAGATTAAAATTTACAATTTAATTGAGTATCTCTGTAGTGTAAAAAAAA
AAAAAAAAAAAAAAA

GM14633.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG6153-RA 827 CG6153-RA 40..782 1..743 3715 100 Plus
CG6153.a 828 CG6153.a 40..782 1..743 3715 100 Plus
CG6153-RB 890 CG6153-RB 40..610 1..571 2855 100 Plus
CG6153-RB 890 CG6153-RB 670..845 568..743 880 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12691716..12692093 1..378 1890 100 Plus
chr2L 23010047 chr2L 12692157..12692349 379..571 965 100 Plus
chr2L 23010047 chr2L 12692409..12692583 568..742 875 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:24:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12693025..12693402 1..378 1890 100 Plus
2L 23513712 2L 12693466..12693658 379..571 965 100 Plus
2L 23513712 2L 12693718..12693893 568..743 880 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12693025..12693402 1..378 1890 100 Plus
2L 23513712 2L 12693466..12693658 379..571 965 100 Plus
2L 23513712 2L 12693718..12693893 568..743 880 100 Plus
Blast to na_te.dros performed 2019-03-16 17:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
Ddip\Bari1 1677 Ddip\Bari1 DDBARI1 1676bp Derived from Y13852. 1373..1422 57..6 110 73.1 Minus

GM14633.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:23:19 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12691716..12692093 1..378 100 -> Plus
chr2L 12692157..12692347 379..569 100 -> Plus
chr2L 12692411..12692583 570..742 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:08 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
CG6153-RA 1..636 59..694 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:57:37 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
CG6153-RA 1..636 59..694 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:55:21 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
CG6153-RA 1..636 59..694 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:48:28 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
CG6153-RA 1..636 59..694 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:58:08 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
CG6153-RA 1..636 59..694 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:13:52 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
CG6153-RA 40..781 1..742 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:57:37 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
CG6153-RA 40..781 1..742 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:55:21 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
CG6153-RA 33..774 1..742 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:28 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
CG6153-RA 3..744 1..742 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:58:08 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
CG6153-RA 33..774 1..742 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:23:19 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12693466..12693656 379..569 100 -> Plus
2L 12693720..12693892 570..742 100   Plus
2L 12693025..12693402 1..378 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:23:19 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12693466..12693656 379..569 100 -> Plus
2L 12693720..12693892 570..742 100   Plus
2L 12693025..12693402 1..378 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:23:19 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12693466..12693656 379..569 100 -> Plus
2L 12693720..12693892 570..742 100   Plus
2L 12693025..12693402 1..378 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:55:21 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12693025..12693402 1..378 100 -> Plus
arm_2L 12693466..12693656 379..569 100 -> Plus
arm_2L 12693720..12693892 570..742 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:19:51 Download gff for GM14633.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12693466..12693656 379..569 100 -> Plus
2L 12693720..12693892 570..742 100   Plus
2L 12693025..12693402 1..378 100 -> Plus

GM14633.hyp Sequence

Translation from 0 to 693

> GM14633.hyp
SAALFTLNFCSIFEFKIKIMPHGHSHDHGGCSHEASDVDHALEMGIEYSL
YTKIDLDNVECLNEETDGQGKSVFKPYEKRQDLSKYVESDADEELLFNIP
FTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFDDARAKPDQEFQLTR
DARGEIEYSPKVVTFSSVHHLSLYFPSNFGEDITRIYYIGLRGEFTEAHY
HGVTICNYESRANAADHKEKAFDGVGRAIQ*

GM14633.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG6153-PC 211 CG6153-PC 1..211 20..230 1130 100 Plus
CG6153-PA 211 CG6153-PA 1..211 20..230 1130 100 Plus

GM14633.pep Sequence

Translation from 58 to 693

> GM14633.pep
MPHGHSHDHGGCSHEASDVDHALEMGIEYSLYTKIDLDNVECLNEETDGQ
GKSVFKPYEKRQDLSKYVESDADEELLFNIPFTGNIKLKGIIISGANDDS
HPNMVKIFKNRPRMTFDDARAKPDQEFQLTRDARGEIEYSPKVVTFSSVH
HLSLYFPSNFGEDITRIYYIGLRGEFTEAHYHGVTICNYESRANAADHKE
KAFDGVGRAIQ*

GM14633.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14204-PA 213 GF14204-PA 11..213 9..211 996 90.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23793-PA 211 GG23793-PA 1..211 1..211 1104 97.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11652-PA 212 GH11652-PA 13..212 12..211 971 87.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6153-PC 211 CG6153-PC 1..211 1..211 1130 100 Plus
CG6153-PA 211 CG6153-PA 1..211 1..211 1130 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17954-PA 212 GI17954-PA 1..212 1..211 983 83.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19722-PA 211 GL19722-PA 1..211 1..211 1007 86.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19395-PA 211 GA19395-PA 1..211 1..211 1011 86.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26892-PA 211 GM26892-PA 1..211 1..211 1125 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23848-PA 211 GD23848-PA 1..211 1..211 1122 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17725-PA 212 GJ17725-PA 16..212 15..211 922 85.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18266-PA 207 GK18266-PA 1..207 1..206 952 83.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18597-PA 211 GE18597-PA 1..211 1..211 1113 98.1 Plus