![]() | BDGP Sequence Production Resources |
Search the DGRC for GM14633
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 146 |
Well: | 33 |
Vector: | pOT2 |
Associated Gene/Transcript | CG6153-RA |
Protein status: | GM14633.pep: gold |
Preliminary Size: | 1300 |
Sequenced Size: | 765 |
Gene | Date | Evidence |
---|---|---|
CG6153 | 2001-01-01 | Release 2 assignment |
CG6153 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6153 | 2003-01-14 | Blastp of sequenced clone |
CG6153 | 2008-04-29 | Release 5.5 accounting |
CG6153 | 2008-08-15 | Release 5.9 accounting |
CG6153 | 2008-12-18 | 5.12 accounting |
765 bp (765 high quality bases) assembled on 2003-01-14
GenBank Submission: AY060988
> GM14633.complete CTCGGCTGCTTTATTTACATTGAATTTTTGTTCGATTTTTGAATTTAAAA TAAAAATAATGCCGCACGGACACTCTCACGATCACGGCGGCTGCAGCCAC GAGGCCTCGGACGTGGACCACGCCCTAGAAATGGGCATCGAGTACAGCTT GTACACCAAAATCGATCTGGACAATGTGGAGTGCCTGAACGAGGAGACGG ATGGCCAGGGAAAAAGTGTCTTTAAGCCGTACGAGAAGCGCCAGGATCTG TCCAAGTACGTGGAGAGCGATGCGGATGAAGAGCTCCTCTTCAACATTCC CTTCACCGGCAACATCAAGCTCAAGGGCATCATCATAAGTGGGGCCAATG ATGACTCCCATCCAAACATGGTCAAAATCTTCAAGAACCGACCCAGGATG ACCTTTGATGATGCCAGAGCAAAGCCCGACCAGGAGTTCCAGCTGACCCG CGATGCCCGCGGAGAAATCGAGTACTCACCCAAAGTGGTCACCTTCTCCT CCGTGCACCATCTCTCCCTCTACTTTCCCAGCAATTTTGGCGAAGACATA ACACGCATTTACTATATAGGTCTTCGAGGAGAGTTCACAGAAGCTCATTA CCATGGCGTAACCATATGCAACTACGAATCCCGTGCCAATGCAGCGGATC ACAAGGAAAAGGCTTTCGATGGAGTCGGCAGAGCCATCCAATAGGGTTAT AGAGATTAAAATTTACAATTTAATTGAGTATCTCTGTAGTGTAAAAAAAA AAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6153-RA | 827 | CG6153-RA | 40..782 | 1..743 | 3715 | 100 | Plus |
CG6153.a | 828 | CG6153.a | 40..782 | 1..743 | 3715 | 100 | Plus |
CG6153-RB | 890 | CG6153-RB | 40..610 | 1..571 | 2855 | 100 | Plus |
CG6153-RB | 890 | CG6153-RB | 670..845 | 568..743 | 880 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 12691716..12692093 | 1..378 | 1890 | 100 | Plus |
chr2L | 23010047 | chr2L | 12692157..12692349 | 379..571 | 965 | 100 | Plus |
chr2L | 23010047 | chr2L | 12692409..12692583 | 568..742 | 875 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 12693025..12693402 | 1..378 | 1890 | 100 | Plus |
2L | 23513712 | 2L | 12693466..12693658 | 379..571 | 965 | 100 | Plus |
2L | 23513712 | 2L | 12693718..12693893 | 568..743 | 880 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 12693025..12693402 | 1..378 | 1890 | 100 | Plus |
2L | 23513712 | 2L | 12693466..12693658 | 379..571 | 965 | 100 | Plus |
2L | 23513712 | 2L | 12693718..12693893 | 568..743 | 880 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ddip\Bari1 | 1677 | Ddip\Bari1 DDBARI1 1676bp Derived from Y13852. | 1373..1422 | 57..6 | 110 | 73.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 12691716..12692093 | 1..378 | 100 | -> | Plus |
chr2L | 12692157..12692347 | 379..569 | 100 | -> | Plus |
chr2L | 12692411..12692583 | 570..742 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6153-RA | 1..636 | 59..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6153-RA | 1..636 | 59..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6153-RA | 1..636 | 59..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6153-RA | 1..636 | 59..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6153-RA | 1..636 | 59..694 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6153-RA | 40..781 | 1..742 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6153-RA | 40..781 | 1..742 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6153-RA | 33..774 | 1..742 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6153-RA | 3..744 | 1..742 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6153-RA | 33..774 | 1..742 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 12693466..12693656 | 379..569 | 100 | -> | Plus |
2L | 12693720..12693892 | 570..742 | 100 | Plus | |
2L | 12693025..12693402 | 1..378 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 12693466..12693656 | 379..569 | 100 | -> | Plus |
2L | 12693720..12693892 | 570..742 | 100 | Plus | |
2L | 12693025..12693402 | 1..378 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 12693466..12693656 | 379..569 | 100 | -> | Plus |
2L | 12693720..12693892 | 570..742 | 100 | Plus | |
2L | 12693025..12693402 | 1..378 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 12693025..12693402 | 1..378 | 100 | -> | Plus |
arm_2L | 12693466..12693656 | 379..569 | 100 | -> | Plus |
arm_2L | 12693720..12693892 | 570..742 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 12693466..12693656 | 379..569 | 100 | -> | Plus |
2L | 12693720..12693892 | 570..742 | 100 | Plus | |
2L | 12693025..12693402 | 1..378 | 100 | -> | Plus |
Translation from 0 to 693
> GM14633.hyp SAALFTLNFCSIFEFKIKIMPHGHSHDHGGCSHEASDVDHALEMGIEYSL YTKIDLDNVECLNEETDGQGKSVFKPYEKRQDLSKYVESDADEELLFNIP FTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFDDARAKPDQEFQLTR DARGEIEYSPKVVTFSSVHHLSLYFPSNFGEDITRIYYIGLRGEFTEAHY HGVTICNYESRANAADHKEKAFDGVGRAIQ*
Translation from 58 to 693
> GM14633.pep MPHGHSHDHGGCSHEASDVDHALEMGIEYSLYTKIDLDNVECLNEETDGQ GKSVFKPYEKRQDLSKYVESDADEELLFNIPFTGNIKLKGIIISGANDDS HPNMVKIFKNRPRMTFDDARAKPDQEFQLTRDARGEIEYSPKVVTFSSVH HLSLYFPSNFGEDITRIYYIGLRGEFTEAHYHGVTICNYESRANAADHKE KAFDGVGRAIQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14204-PA | 213 | GF14204-PA | 11..213 | 9..211 | 996 | 90.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23793-PA | 211 | GG23793-PA | 1..211 | 1..211 | 1104 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11652-PA | 212 | GH11652-PA | 13..212 | 12..211 | 971 | 87.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6153-PC | 211 | CG6153-PC | 1..211 | 1..211 | 1130 | 100 | Plus |
CG6153-PA | 211 | CG6153-PA | 1..211 | 1..211 | 1130 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17954-PA | 212 | GI17954-PA | 1..212 | 1..211 | 983 | 83.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19722-PA | 211 | GL19722-PA | 1..211 | 1..211 | 1007 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19395-PA | 211 | GA19395-PA | 1..211 | 1..211 | 1011 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26892-PA | 211 | GM26892-PA | 1..211 | 1..211 | 1125 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23848-PA | 211 | GD23848-PA | 1..211 | 1..211 | 1122 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17725-PA | 212 | GJ17725-PA | 16..212 | 15..211 | 922 | 85.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18266-PA | 207 | GK18266-PA | 1..207 | 1..206 | 952 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18597-PA | 211 | GE18597-PA | 1..211 | 1..211 | 1113 | 98.1 | Plus |