Clone GM14788 Report

Search the DGRC for GM14788

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:147
Well:88
Vector:pOT2
Associated Gene/TranscriptJafrac1-RA
Protein status:GM14788.pep: gold
Preliminary Size:1300
Sequenced Size:1006

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1633 2001-01-01 Release 2 assignment
CG1633 2003-01-01 Sim4 clustering to Release 3
CG1633 2003-02-24 Blastp of sequenced clone
Jafrac1 2008-04-29 Release 5.5 accounting
Jafrac1 2008-08-15 Release 5.9 accounting
Jafrac1 2008-12-18 5.12 accounting

Clone Sequence Records

GM14788.complete Sequence

1006 bp (1006 high quality bases) assembled on 2003-02-24

GenBank Submission: AY070534

> GM14788.complete
TGCCGAAAGGTTTGTTTGTCCGAAAGCTGCAGCTGCGAGAGAACGAGCAA
GAGGAAGCCCACGCGGAAGTCAAGCAATTACCGAGAATTACTAAGAGAAA
AAATATAACTGTTTAAAATGCCCCAGCTACAGAAGCCCGCTCCCGCATTC
GCCGGCACCGCCGTCGTCAACGGTGTTTTCAAGGACATCAAGTTGAGCGA
CTACAAGGGCAAATACCTGGTGCTTTTCTTCTACCCGCTGGACTTCACCT
TCGTGTGCCCCACCGAGATCATTGCGTTCTCGGAGAGCGCCGCCGAGTTC
CGCAAGATCAATTGCGAGGTGATCGGTTGCTCCACGGACAGCCAGTTCAC
CCACTTGGCCTGGATCAACACGCCAAGGAAGCAGGGTGGTCTGGGCAGCA
TGGACATTCCACTGCTGGCTGACAAGTCGATGAAGGTGGCCCGCGACTAT
GGAGTGCTCGATGAGGAGACTGGCATCCCCTTCCGCGGCCTGTTCATCAT
CGATGACAAGCAGAACTTGCGCCAGATCACCGTCAACGATCTGCCCGTAG
GTCGCAGTGTGGAGGAGACCCTGCGTCTCGTCCAGGCCTTCCAGTACACC
GACAAGTACGGCGAGGTCTGCCCCGCCAACTGGAAGCCCGGCCAGAAGAC
CATGGTGGCCGATCCCACCAAGTCCAAGGAGTACTTCGAGACCACCTCCT
AAAGAGGCTATCTGTTCGCTGAACGGGGCCGCTCCTGGCGAGTGGGAGTG
GATTCGAATCGCAAACCCCCCGTTCAACTAAAACCAATACATATACTACA
TTATATATCCTACACATTAACCCTAGAGCGTAGAAGAAGAAGAAACTGTG
AGGCATCTTTCCCTGCAACAGCGCCACCCAAAAATAAGATGATAAACACC
TGCAGACGCTAAGCGGAAAGTGATTATTTTTTACGTATATTTTGTGTGCT
TTTTTTTGTAATTCACCACAATAAACGATTGTACGGAAAAAAAAAAAAAA
AAAAAA

GM14788.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Jafrac1-RB 1307 Jafrac1-RB 132..1122 1..987 4825 99.2 Plus
Jafrac1-RA 1013 Jafrac1-RA 138..1011 118..987 4285 99.5 Plus
Jafrac2-RA 1056 Jafrac2-RA 344..456 211..323 250 81.4 Plus
Jafrac2-RA 1056 Jafrac2-RA 651..756 518..623 185 78.3 Plus
Jafrac2-RA 1056 Jafrac2-RA 479..549 346..416 160 81.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13221953..13222823 118..986 4290 99.8 Plus
chrX 22417052 chrX 13220676..13220792 1..117 585 100 Plus
chr3L 24539361 chr3L 15198265..15198570 358..663 390 75.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:24:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13331122..13331995 118..987 4275 99.5 Plus
X 23542271 X 13329848..13329964 1..117 540 97.4 Plus
3L 28110227 3L 15208172..15208477 358..663 390 75.2 Plus
3L 28110227 3L 3043713..3043818 518..623 185 78.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13339220..13340093 118..987 4285 99.5 Plus
X 23527363 X 13337946..13338062 1..117 540 97.4 Plus
3L 28103327 3L 15201434..15201577 520..663 255 78.4 Plus
3L 28103327 3L 15201272..15201381 358..467 190 78.1 Plus
3L 28103327 3L 3043713..3043818 518..623 185 78.3 Plus
3L 28103327 3L 3043541..3043611 346..416 160 81.6 Plus
3L 28103327 3L 3043441..3043518 246..323 150 79.4 Plus
Blast to na_te.dros performed 2019-03-16 07:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\ISBu3 993 Dbuz\ISBu3 ISBU3 993bp 405..446 963..922 111 73.8 Minus

GM14788.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:34:36 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13220676..13220792 1..117 100 -> Plus
chrX 13221953..13222823 118..986 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:14 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
Jafrac1-RA 1..585 118..702 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:48:37 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
Jafrac1-RA 1..585 118..702 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:01:50 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
Jafrac1-RA 1..585 118..702 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:01 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
Jafrac1-RA 1..585 118..702 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:38 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
Jafrac1-RC 1..585 118..702 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:03 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
Jafrac1-RB 1..990 1..986 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:48:37 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
Jafrac1-RB 1..990 1..986 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:01:50 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
Jafrac1-RB 25..1014 1..986 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:01 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
Jafrac1-RB 1..990 1..986 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:38 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
Jafrac1-RB 25..1014 1..986 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:34:36 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
X 13329848..13329964 1..117 97 -> Plus
X 13331122..13331994 118..986 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:34:36 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
X 13329848..13329964 1..117 97 -> Plus
X 13331122..13331994 118..986 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:34:36 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
X 13329848..13329964 1..117 97 -> Plus
X 13331122..13331994 118..986 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:01:50 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13223881..13223997 1..117 97 -> Plus
arm_X 13225155..13226027 118..986 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:22 Download gff for GM14788.complete
Subject Subject Range Query Range Percent Splice Strand
X 13339220..13340092 118..986 99   Plus
X 13337946..13338062 1..117 97 -> Plus

GM14788.pep Sequence

Translation from 117 to 701

> GM14788.pep
MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTE
IIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLL
ADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEE
TLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETTS*

GM14788.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19402-PA 194 GF19402-PA 1..194 1..194 1018 97.4 Plus
Dana\GF24261-PA 244 GF24261-PA 53..239 4..190 690 67.4 Plus
Dana\GF23670-PA 196 GF23670-PA 3..196 1..194 655 57.7 Plus
Dana\GF15932-PA 234 GF15932-PA 41..230 3..190 608 57.9 Plus
Dana\GF12124-PA 220 GF12124-PA 19..192 24..188 246 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17772-PA 194 GG17772-PA 1..194 1..194 1029 98.5 Plus
Dere\GG15885-PA 196 GG15885-PA 3..193 1..191 688 61.8 Plus
Dere\GG14898-PA 242 GG14898-PA 52..238 4..190 681 66.3 Plus
Dere\GG16768-PA 234 GG16768-PA 41..230 3..190 607 57.9 Plus
Dere\GG24478-PA 222 GG24478-PA 34..195 33..188 250 34 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15986-PA 243 GH15986-PA 53..239 4..190 675 66.3 Plus
Dgri\GH14416-PA 195 GH14416-PA 1..195 1..194 626 55.4 Plus
Dgri\GH17487-PA 231 GH17487-PA 38..227 3..190 607 58.4 Plus
Dgri\GH17696-PA 288 GH17696-PA 176..269 1..94 460 89.4 Plus
Dgri\GH20103-PA 220 GH20103-PA 19..185 24..180 239 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Jafrac1-PE 194 CG1633-PE 1..194 1..194 1021 100 Plus
Jafrac1-PD 194 CG1633-PD 1..194 1..194 1021 100 Plus
Jafrac1-PC 194 CG1633-PC 1..194 1..194 1021 100 Plus
Jafrac1-PA 194 CG1633-PA 1..194 1..194 1021 100 Plus
Jafrac1-PB 194 CG1633-PB 1..194 1..194 1021 100 Plus
CG6888-PA 196 CG6888-PA 3..193 1..191 665 61.8 Plus
Jafrac2-PC 242 CG1274-PC 52..238 4..190 657 66.3 Plus
Jafrac2-PB 242 CG1274-PB 52..238 4..190 657 66.3 Plus
Jafrac2-PA 242 CG1274-PA 52..238 4..190 657 66.3 Plus
Prx3-PA 234 CG5826-PA 41..230 3..190 594 57.9 Plus
Prx6005-PA 222 CG3083-PA 34..195 33..188 250 34 Plus
Prx2540-2-PA 220 CG11765-PA 19..192 24..188 231 34.9 Plus
Prx2540-1-PA 220 CG12405-PA 19..192 24..188 230 34.9 Plus
CG12896-PA 220 CG12896-PA 19..185 24..180 228 34.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16105-PA 194 GI16105-PA 1..193 1..193 982 93.3 Plus
Dmoj\GI16636-PA 243 GI16636-PA 53..239 4..190 689 67.4 Plus
Dmoj\GI13545-PA 268 GI13545-PA 74..267 1..193 627 57.7 Plus
Dmoj\GI22813-PA 233 GI22813-PA 40..229 3..190 619 59.5 Plus
Dmoj\GI17568-PA 224 GI17568-PA 34..187 33..180 236 34.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26916-PA 194 GL26916-PA 1..194 1..194 1014 97.4 Plus
Dper\GL20930-PA 194 GL20930-PA 1..194 1..194 651 59.3 Plus
Dper\GL16320-PA 204 GL16320-PA 15..200 6..190 638 64.5 Plus
Dper\GL13701-PA 233 GL13701-PA 40..229 3..190 602 57.4 Plus
Dper\GL11593-PA 220 GL11593-PA 19..192 24..188 231 33.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14060-PA 200 GA14060-PA 7..200 1..194 1016 97.4 Plus
Dpse\GA11781-PA 243 GA11781-PA 53..239 4..190 681 66.8 Plus
Dpse\GA28632-PA 194 GA28632-PA 1..194 1..194 645 58.8 Plus
Dpse\GA19159-PA 233 GA19159-PA 40..229 3..190 602 57.4 Plus
Dpse\GA11614-PA 220 GA11614-PA 19..192 24..188 231 33.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11621-PA 194 GM11621-PA 1..194 1..194 1037 100 Plus
Dsec\GM25516-PA 196 GM25516-PA 3..193 1..191 687 61.8 Plus
Dsec\GM14524-PA 242 GM14524-PA 52..238 4..190 676 66.3 Plus
Dsec\GM16948-PA 234 GM16948-PA 41..230 3..190 608 57.9 Plus
Dsec\GM21216-PA 220 GM21216-PA 19..192 24..188 244 34.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17115-PA 194 GD17115-PA 1..194 1..194 1037 100 Plus
Dsim\GD14531-PA 196 GD14531-PA 3..193 1..191 687 61.8 Plus
Dsim\GD13721-PA 242 GD13721-PA 52..238 4..190 676 66.3 Plus
Dsim\GD20225-PA 234 GD20225-PA 41..230 3..190 608 57.9 Plus
Dsim\GD22792-PA 222 GD22792-PA 34..195 33..188 243 32.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15754-PA 194 GJ15754-PA 1..194 1..194 972 92.8 Plus
Dvir\GJ12891-PA 244 GJ12891-PA 54..240 4..190 688 67.9 Plus
Dvir\GJ11904-PA 195 GJ11904-PA 1..195 1..194 632 57.4 Plus
Dvir\GJ22817-PA 233 GJ22817-PA 40..229 3..190 618 59.5 Plus
Dvir\GJ17911-PA 224 GJ17911-PA 34..187 33..180 254 35.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25196-PA 213 GK25196-PA 20..213 1..194 1003 94.8 Plus
Dwil\GK16580-PA 248 GK16580-PA 58..244 4..190 694 68.4 Plus
Dwil\GK20591-PA 196 GK20591-PA 3..195 1..193 647 57.5 Plus
Dwil\GK19651-PA 196 GK19651-PA 3..195 1..193 643 57 Plus
Dwil\GK12986-PA 233 GK12986-PA 40..229 3..190 613 58.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Jafrac1-PA 194 GE17062-PA 1..194 1..194 1032 99.5 Plus
Dyak\GE22230-PA 196 GE22230-PA 3..196 1..194 688 60.8 Plus
Dyak\GE20352-PA 242 GE20352-PA 52..238 4..190 678 66.3 Plus
Dyak\GE25263-PA 234 GE25263-PA 41..230 3..190 608 57.9 Plus
Dyak\GE14982-PA 222 GE14982-PA 34..195 33..188 246 33.3 Plus

GM14788.hyp Sequence

Translation from 117 to 701

> GM14788.hyp
MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTE
IIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLL
ADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEE
TLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETTS*

GM14788.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
Jafrac1-PE 194 CG1633-PE 1..194 1..194 1021 100 Plus
Jafrac1-PD 194 CG1633-PD 1..194 1..194 1021 100 Plus
Jafrac1-PC 194 CG1633-PC 1..194 1..194 1021 100 Plus
Jafrac1-PA 194 CG1633-PA 1..194 1..194 1021 100 Plus
Jafrac1-PB 194 CG1633-PB 1..194 1..194 1021 100 Plus