BDGP Sequence Production Resources |
Search the DGRC for GM14851
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 148 |
Well: | 51 |
Vector: | pOT2 |
Associated Gene/Transcript | CG10418-RA |
Protein status: | GM14851.pep: gold |
Preliminary Size: | 647 |
Sequenced Size: | 456 |
Gene | Date | Evidence |
---|---|---|
CG10418 | 2001-11-29 | Blastp of sequenced clone |
CG10418 | 2002-01-01 | Sim4 clustering to Release 2 |
CG10418 | 2003-01-01 | Sim4 clustering to Release 3 |
CG10418 | 2008-04-29 | Release 5.5 accounting |
CG10418 | 2008-08-15 | Release 5.9 accounting |
CG10418 | 2008-12-18 | 5.12 accounting |
456 bp assembled on 2006-11-09
GenBank Submission: AY070862
> GM14851.complete AAAACAACGCGTTCGTCGAAATTGCAATAAACAATAACAATGCTCTTTTA CTCCTTCTTCAAGTCGCTGGTGGGCAAGGAAGTCGTTGTGGAGTTGAAAA ACGACCTCAGCATATGTGGCACCCTGCACTCGGTGGATCAGTACCTGAAC ATCAAGCTGACGGATATCAGTGTCACAGATCCGGACAAGTACCCCCACAT GCTGAGCGTCAAGAACTGCTTCATCCGTGGCTCCGTGGTGCGATACGTGC AGCTGCCGGGCGACGAGGTGGACACCCAGCTGCTCCAGGATGCGGCGCGA AAGGAGGCTGTTGTGAGCACAAGATAAGAATACCACTACCAGCAGCCCAA TTGGATCTACCCATTGCTTCGTAAACTGTCCTAAAAACCTAAGTGAAATT CTGTTAAAGCAAAACCAATAAGAGGAATCCCCGTATTAAAAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 12327594..12327923 | 108..437 | 1650 | 100 | Plus |
chr3L | 24539361 | chr3L | 12327465..12327533 | 42..110 | 330 | 98.6 | Plus |
chr3L | 24539361 | chr3L | 12327363..12327404 | 1..42 | 210 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 12327363..12327404 | 1..42 | 100 | -> | Plus |
chr3L | 12327466..12327533 | 43..110 | 98 | -> | Plus |
chr3L | 12327597..12327923 | 111..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10418-RA | 1..288 | 40..327 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10418-RA | 1..288 | 40..327 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10418-RA | 1..288 | 40..327 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10418-RA | 1..288 | 40..327 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10418-RA | 1..288 | 40..327 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10418-RA | 1..437 | 1..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10418-RA | 1..437 | 1..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10418-RA | 1..437 | 1..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10418-RA | 1..437 | 1..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10418-RA | 1..437 | 1..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12336676..12336717 | 1..42 | 100 | -> | Plus |
3L | 12336779..12336846 | 43..110 | 100 | -> | Plus |
3L | 12336910..12337236 | 111..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12336676..12336717 | 1..42 | 100 | -> | Plus |
3L | 12336779..12336846 | 43..110 | 100 | -> | Plus |
3L | 12336910..12337236 | 111..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12336676..12336717 | 1..42 | 100 | -> | Plus |
3L | 12336779..12336846 | 43..110 | 100 | -> | Plus |
3L | 12336910..12337236 | 111..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 12329776..12329817 | 1..42 | 100 | -> | Plus |
arm_3L | 12329879..12329946 | 43..110 | 100 | -> | Plus |
arm_3L | 12330010..12330336 | 111..437 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12329776..12329817 | 1..42 | 100 | -> | Plus |
3L | 12329879..12329946 | 43..110 | 100 | -> | Plus |
3L | 12330010..12330336 | 111..437 | 100 | Plus |
Translation from 2 to 373
> GM14851.hyp NNAFVEIAINNNNALLLLLQVAGGQGSRCGVEKRPQHMWHPALGGSVPEH QADGYQCHRSGQVPPHAERQELLHPWLRGAIRAAAGRRGGHPAAPGCGAK GGCCEHKIRIPLPAAQLDLPIAS*
Translation from 39 to 326
> GM14851.pep MLFYSFFKSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDK YPHMLSVKNCFIRGSVVRYVQLPGDEVDTQLLQDAARKEAVVSTR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24817-PA | 98 | GF24817-PA | 5..98 | 2..95 | 488 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15573-PA | 112 | GG15573-PA | 19..112 | 2..95 | 492 | 100 | Plus |
Dere\GG23936-PA | 154 | GG23936-PA | 1..86 | 1..88 | 131 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15400-PA | 104 | GH15400-PA | 11..104 | 2..95 | 493 | 100 | Plus |
Dgri\GH23600-PA | 94 | GH23600-PA | 1..94 | 2..95 | 490 | 100 | Plus |
Dgri\GH13613-PA | 155 | GH13613-PA | 1..86 | 1..88 | 130 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10418-PA | 95 | CG10418-PA | 1..95 | 1..95 | 483 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13004-PA | 95 | GI13004-PA | 1..95 | 1..95 | 493 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25187-PA | 95 | GL25187-PA | 1..95 | 1..95 | 493 | 98.9 | Plus |
Dper\GL19160-PA | 151 | GL19160-PA | 1..86 | 1..88 | 131 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10305-PA | 95 | GA10305-PA | 1..95 | 1..95 | 493 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25341-PA | 95 | GM25341-PA | 1..95 | 1..95 | 497 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14374-PA | 95 | GD14374-PA | 1..95 | 1..95 | 497 | 100 | Plus |
Dsim\GD22262-PA | 154 | GD22262-PA | 1..86 | 1..88 | 131 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13149-PA | 95 | GJ13149-PA | 1..95 | 1..95 | 497 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10160-PA | 106 | GK10160-PA | 13..106 | 2..95 | 493 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21899-PA | 95 | GE21899-PA | 1..95 | 1..95 | 497 | 100 | Plus |