Clone GM14851 Report

Search the DGRC for GM14851

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:148
Well:51
Vector:pOT2
Associated Gene/TranscriptCG10418-RA
Protein status:GM14851.pep: gold
Preliminary Size:647
Sequenced Size:456

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10418 2001-11-29 Blastp of sequenced clone
CG10418 2002-01-01 Sim4 clustering to Release 2
CG10418 2003-01-01 Sim4 clustering to Release 3
CG10418 2008-04-29 Release 5.5 accounting
CG10418 2008-08-15 Release 5.9 accounting
CG10418 2008-12-18 5.12 accounting

Clone Sequence Records

GM14851.complete Sequence

456 bp assembled on 2006-11-09

GenBank Submission: AY070862

> GM14851.complete
AAAACAACGCGTTCGTCGAAATTGCAATAAACAATAACAATGCTCTTTTA
CTCCTTCTTCAAGTCGCTGGTGGGCAAGGAAGTCGTTGTGGAGTTGAAAA
ACGACCTCAGCATATGTGGCACCCTGCACTCGGTGGATCAGTACCTGAAC
ATCAAGCTGACGGATATCAGTGTCACAGATCCGGACAAGTACCCCCACAT
GCTGAGCGTCAAGAACTGCTTCATCCGTGGCTCCGTGGTGCGATACGTGC
AGCTGCCGGGCGACGAGGTGGACACCCAGCTGCTCCAGGATGCGGCGCGA
AAGGAGGCTGTTGTGAGCACAAGATAAGAATACCACTACCAGCAGCCCAA
TTGGATCTACCCATTGCTTCGTAAACTGTCCTAAAAACCTAAGTGAAATT
CTGTTAAAGCAAAACCAATAAGAGGAATCCCCGTATTAAAAAAAAAAAAA
AAAAAA

GM14851.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG10418-RA 713 CG10418-RA 46..484 1..439 2195 100 Plus
CG10418.a 944 CG10418.a 46..484 1..439 2195 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12327594..12327923 108..437 1650 100 Plus
chr3L 24539361 chr3L 12327465..12327533 42..110 330 98.6 Plus
chr3L 24539361 chr3L 12327363..12327404 1..42 210 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:24:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12336907..12337238 108..439 1660 100 Plus
3L 28110227 3L 12336778..12336846 42..110 345 100 Plus
3L 28110227 3L 12336676..12336717 1..42 210 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12330007..12330338 108..439 1660 100 Plus
3L 28103327 3L 12329878..12329946 42..110 345 100 Plus
3L 28103327 3L 12329776..12329817 1..42 210 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:08:55 has no hits.

GM14851.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:10:11 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12327363..12327404 1..42 100 -> Plus
chr3L 12327466..12327533 43..110 98 -> Plus
chr3L 12327597..12327923 111..437 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:20 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
CG10418-RA 1..288 40..327 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:20:04 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
CG10418-RA 1..288 40..327 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:53:42 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
CG10418-RA 1..288 40..327 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:36:56 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
CG10418-RA 1..288 40..327 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:45 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
CG10418-RA 1..288 40..327 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:21 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
CG10418-RA 1..437 1..437 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:20:04 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
CG10418-RA 1..437 1..437 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:53:42 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
CG10418-RA 1..437 1..437 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:36:56 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
CG10418-RA 1..437 1..437 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:45 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
CG10418-RA 1..437 1..437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:11 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12336676..12336717 1..42 100 -> Plus
3L 12336779..12336846 43..110 100 -> Plus
3L 12336910..12337236 111..437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:11 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12336676..12336717 1..42 100 -> Plus
3L 12336779..12336846 43..110 100 -> Plus
3L 12336910..12337236 111..437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:11 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12336676..12336717 1..42 100 -> Plus
3L 12336779..12336846 43..110 100 -> Plus
3L 12336910..12337236 111..437 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:53:42 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12329776..12329817 1..42 100 -> Plus
arm_3L 12329879..12329946 43..110 100 -> Plus
arm_3L 12330010..12330336 111..437 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:12 Download gff for GM14851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12329776..12329817 1..42 100 -> Plus
3L 12329879..12329946 43..110 100 -> Plus
3L 12330010..12330336 111..437 100   Plus

GM14851.hyp Sequence

Translation from 2 to 373

> GM14851.hyp
NNAFVEIAINNNNALLLLLQVAGGQGSRCGVEKRPQHMWHPALGGSVPEH
QADGYQCHRSGQVPPHAERQELLHPWLRGAIRAAAGRRGGHPAAPGCGAK
GGCCEHKIRIPLPAAQLDLPIAS*
Sequence GM14851.hyp has no blast hits.

GM14851.pep Sequence

Translation from 39 to 326

> GM14851.pep
MLFYSFFKSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDK
YPHMLSVKNCFIRGSVVRYVQLPGDEVDTQLLQDAARKEAVVSTR*

GM14851.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24817-PA 98 GF24817-PA 5..98 2..95 488 98.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15573-PA 112 GG15573-PA 19..112 2..95 492 100 Plus
Dere\GG23936-PA 154 GG23936-PA 1..86 1..88 131 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15400-PA 104 GH15400-PA 11..104 2..95 493 100 Plus
Dgri\GH23600-PA 94 GH23600-PA 1..94 2..95 490 100 Plus
Dgri\GH13613-PA 155 GH13613-PA 1..86 1..88 130 37.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG10418-PA 95 CG10418-PA 1..95 1..95 483 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13004-PA 95 GI13004-PA 1..95 1..95 493 98.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25187-PA 95 GL25187-PA 1..95 1..95 493 98.9 Plus
Dper\GL19160-PA 151 GL19160-PA 1..86 1..88 131 37.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10305-PA 95 GA10305-PA 1..95 1..95 493 98.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25341-PA 95 GM25341-PA 1..95 1..95 497 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14374-PA 95 GD14374-PA 1..95 1..95 497 100 Plus
Dsim\GD22262-PA 154 GD22262-PA 1..86 1..88 131 37.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13149-PA 95 GJ13149-PA 1..95 1..95 497 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10160-PA 106 GK10160-PA 13..106 2..95 493 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21899-PA 95 GE21899-PA 1..95 1..95 497 100 Plus