Clone GM14877 Report

Search the DGRC for GM14877

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:148
Well:77
Vector:pOT2
Associated Gene/TranscriptCG7048-RA
Protein status:GM14877.pep: gold
Preliminary Size:1300
Sequenced Size:688

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7048 2001-01-01 Release 2 assignment
CG7048 2001-07-04 Blastp of sequenced clone
CG7048 2003-01-01 Sim4 clustering to Release 3
CG7048 2008-04-29 Release 5.5 accounting
CG7048 2008-08-15 Release 5.9 accounting
CG7048 2008-12-18 5.12 accounting

Clone Sequence Records

GM14877.complete Sequence

688 bp (688 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051649

> GM14877.complete
CTCGTGCCGAATTCGGCACGAGAGGTGGCAACCTTATACGGCGACTGAAT
AAAATAAAAGTGGAATTGTAAATTATAAGTGTAAGCACTAGCAATGGCTG
CCACCCCAAGCGCACCCGCCAAGTCCGAGATGATCGACCTGACCAAGTTG
AGTCCGGAACAGCTGATTCAGATCAAGCAGGAGTTCGAGCAGGAGATTAC
CAACGTACAGGACTCGCTGTCGACGCTTCACGGCTGTCAAGCCAAGTACG
CCGGATCCAAGGAGGCGCTGGGAACCTTTCAACCCAATTGGGAGAACCGT
CAGATCCTGGTGCCCCTGACCAGCAGTATGTATGTGCCAGGACGGGTCAA
GGATCTCAACAGGTTCGTCATAGACATCGGCACCGGCTACTACATTGAAA
AGGATCTGGAAGGCTCCAAAGACTACTTCAAGCGACGCGTGGAGTACGTG
CAGGAGCAGATCGAGAAAATCGAAAAGATCCACCTGCAAAAGACGCGCTT
CTATAACTCAGTGATGAGTGTGCTGGAGATGAAGCAGGCTGCTGCAGCGA
AATTGCAGTCGCAGCAGCAATCGCAGCCGGCGGTTACCCAGAGCTCCTAG
ACTACGGAGAACGACAGAGACACGAGACACGGAAAGCATTAAATTATTAA
ACTTATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GM14877.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG7048-RB 947 CG7048-RB 185..821 23..659 3185 100 Plus
CG7048-RA 947 CG7048-RA 185..821 23..659 3185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18311343..18311599 401..657 1285 100 Plus
chr3R 27901430 chr3R 18311072..18311284 191..403 1065 100 Plus
chr3R 27901430 chr3R 18310787..18310957 23..193 855 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:24:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22487779..22488037 401..659 1295 100 Plus
3R 32079331 3R 22487508..22487720 191..403 1065 100 Plus
3R 32079331 3R 22487223..22487393 23..193 855 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22228610..22228868 401..659 1295 100 Plus
3R 31820162 3R 22228339..22228551 191..403 1065 100 Plus
3R 31820162 3R 22228054..22228224 23..193 855 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:45:12 has no hits.

GM14877.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:45:54 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18310777..18310956 9..192 97 -> Plus
chr3R 18311074..18311283 193..402 100 -> Plus
chr3R 18311345..18311599 403..657 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:23 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
CG7048-RA 1..507 94..600 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:22:57 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
CG7048-RB 1..507 94..600 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:34:40 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
CG7048-RA 1..507 94..600 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:55:39 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
CG7048-RA 1..507 94..600 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:10 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
CG7048-RA 1..507 94..600 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:20:26 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
CG7048-RA 9..653 9..657 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:22:57 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
CG7048-RB 15..659 9..657 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:34:40 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
CG7048-RA 15..659 9..657 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:55:39 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
CG7048-RA 9..653 9..657 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:10 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
CG7048-RA 13..657 9..657 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:45:54 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22487213..22487392 9..192 97 -> Plus
3R 22487510..22487719 193..402 100 -> Plus
3R 22487781..22488035 403..657 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:45:54 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22487213..22487392 9..192 97 -> Plus
3R 22487510..22487719 193..402 100 -> Plus
3R 22487781..22488035 403..657 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:45:54 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22487213..22487392 9..192 97 -> Plus
3R 22487510..22487719 193..402 100 -> Plus
3R 22487781..22488035 403..657 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:34:40 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18312935..18313114 9..192 97 -> Plus
arm_3R 18313232..18313441 193..402 100 -> Plus
arm_3R 18313503..18313757 403..657 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:33:24 Download gff for GM14877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22228044..22228223 9..192 97 -> Plus
3R 22228341..22228550 193..402 100 -> Plus
3R 22228612..22228866 403..657 100   Plus

GM14877.hyp Sequence

Translation from 93 to 599

> GM14877.hyp
MAATPSAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQA
KYAGSKEALGTFQPNWENRQILVPLTSSMYVPGRVKDLNRFVIDIGTGYY
IEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSVMSVLEMKQAA
AAKLQSQQQSQPAVTQSS*

GM14877.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG7048-PB 168 CG7048-PB 1..168 1..168 846 100 Plus
CG7048-PA 168 CG7048-PA 1..168 1..168 846 100 Plus

GM14877.pep Sequence

Translation from 93 to 599

> GM14877.pep
MAATPSAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQA
KYAGSKEALGTFQPNWENRQILVPLTSSMYVPGRVKDLNRFVIDIGTGYY
IEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSVMSVLEMKQAA
AAKLQSQQQSQPAVTQSS*

GM14877.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18855-PA 170 GF18855-PA 1..154 1..154 737 87 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11141-PA 168 GG11141-PA 1..168 1..168 792 91.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22251-PA 168 GH22251-PA 1..154 1..154 729 85.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Pfdn5-PB 168 CG7048-PB 1..168 1..168 846 100 Plus
Pfdn5-PA 168 CG7048-PA 1..168 1..168 846 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21980-PA 168 GI21980-PA 1..154 1..154 716 84.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24222-PA 168 GL24222-PA 1..154 1..154 728 87.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20058-PA 168 GA20058-PA 1..154 1..154 733 88.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26439-PA 168 GM26439-PA 1..168 1..168 874 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20958-PA 168 GD20958-PA 1..168 1..168 874 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14341-PA 168 GJ14341-PA 1..147 1..147 709 87.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12815-PA 167 GK12815-PA 1..146 1..146 691 86.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10307-PA 168 GE10307-PA 1..168 1..168 791 88.7 Plus