BDGP Sequence Production Resources |
Search the DGRC for GM14877
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 148 |
Well: | 77 |
Vector: | pOT2 |
Associated Gene/Transcript | CG7048-RA |
Protein status: | GM14877.pep: gold |
Preliminary Size: | 1300 |
Sequenced Size: | 688 |
Gene | Date | Evidence |
---|---|---|
CG7048 | 2001-01-01 | Release 2 assignment |
CG7048 | 2001-07-04 | Blastp of sequenced clone |
CG7048 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7048 | 2008-04-29 | Release 5.5 accounting |
CG7048 | 2008-08-15 | Release 5.9 accounting |
CG7048 | 2008-12-18 | 5.12 accounting |
688 bp (688 high quality bases) assembled on 2001-07-04
GenBank Submission: AY051649
> GM14877.complete CTCGTGCCGAATTCGGCACGAGAGGTGGCAACCTTATACGGCGACTGAAT AAAATAAAAGTGGAATTGTAAATTATAAGTGTAAGCACTAGCAATGGCTG CCACCCCAAGCGCACCCGCCAAGTCCGAGATGATCGACCTGACCAAGTTG AGTCCGGAACAGCTGATTCAGATCAAGCAGGAGTTCGAGCAGGAGATTAC CAACGTACAGGACTCGCTGTCGACGCTTCACGGCTGTCAAGCCAAGTACG CCGGATCCAAGGAGGCGCTGGGAACCTTTCAACCCAATTGGGAGAACCGT CAGATCCTGGTGCCCCTGACCAGCAGTATGTATGTGCCAGGACGGGTCAA GGATCTCAACAGGTTCGTCATAGACATCGGCACCGGCTACTACATTGAAA AGGATCTGGAAGGCTCCAAAGACTACTTCAAGCGACGCGTGGAGTACGTG CAGGAGCAGATCGAGAAAATCGAAAAGATCCACCTGCAAAAGACGCGCTT CTATAACTCAGTGATGAGTGTGCTGGAGATGAAGCAGGCTGCTGCAGCGA AATTGCAGTCGCAGCAGCAATCGCAGCCGGCGGTTACCCAGAGCTCCTAG ACTACGGAGAACGACAGAGACACGAGACACGGAAAGCATTAAATTATTAA ACTTATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 18311343..18311599 | 401..657 | 1285 | 100 | Plus |
chr3R | 27901430 | chr3R | 18311072..18311284 | 191..403 | 1065 | 100 | Plus |
chr3R | 27901430 | chr3R | 18310787..18310957 | 23..193 | 855 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 22487779..22488037 | 401..659 | 1295 | 100 | Plus |
3R | 32079331 | 3R | 22487508..22487720 | 191..403 | 1065 | 100 | Plus |
3R | 32079331 | 3R | 22487223..22487393 | 23..193 | 855 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 22228610..22228868 | 401..659 | 1295 | 100 | Plus |
3R | 31820162 | 3R | 22228339..22228551 | 191..403 | 1065 | 100 | Plus |
3R | 31820162 | 3R | 22228054..22228224 | 23..193 | 855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 18310777..18310956 | 9..192 | 97 | -> | Plus |
chr3R | 18311074..18311283 | 193..402 | 100 | -> | Plus |
chr3R | 18311345..18311599 | 403..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7048-RA | 1..507 | 94..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7048-RB | 1..507 | 94..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7048-RA | 1..507 | 94..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7048-RA | 1..507 | 94..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7048-RA | 1..507 | 94..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7048-RA | 9..653 | 9..657 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7048-RB | 15..659 | 9..657 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7048-RA | 15..659 | 9..657 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7048-RA | 9..653 | 9..657 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7048-RA | 13..657 | 9..657 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22487213..22487392 | 9..192 | 97 | -> | Plus |
3R | 22487510..22487719 | 193..402 | 100 | -> | Plus |
3R | 22487781..22488035 | 403..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22487213..22487392 | 9..192 | 97 | -> | Plus |
3R | 22487510..22487719 | 193..402 | 100 | -> | Plus |
3R | 22487781..22488035 | 403..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22487213..22487392 | 9..192 | 97 | -> | Plus |
3R | 22487510..22487719 | 193..402 | 100 | -> | Plus |
3R | 22487781..22488035 | 403..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 18312935..18313114 | 9..192 | 97 | -> | Plus |
arm_3R | 18313232..18313441 | 193..402 | 100 | -> | Plus |
arm_3R | 18313503..18313757 | 403..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22228044..22228223 | 9..192 | 97 | -> | Plus |
3R | 22228341..22228550 | 193..402 | 100 | -> | Plus |
3R | 22228612..22228866 | 403..657 | 100 | Plus |
Translation from 93 to 599
> GM14877.hyp MAATPSAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQA KYAGSKEALGTFQPNWENRQILVPLTSSMYVPGRVKDLNRFVIDIGTGYY IEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSVMSVLEMKQAA AAKLQSQQQSQPAVTQSS*
Translation from 93 to 599
> GM14877.pep MAATPSAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQA KYAGSKEALGTFQPNWENRQILVPLTSSMYVPGRVKDLNRFVIDIGTGYY IEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSVMSVLEMKQAA AAKLQSQQQSQPAVTQSS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18855-PA | 170 | GF18855-PA | 1..154 | 1..154 | 737 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11141-PA | 168 | GG11141-PA | 1..168 | 1..168 | 792 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22251-PA | 168 | GH22251-PA | 1..154 | 1..154 | 729 | 85.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pfdn5-PB | 168 | CG7048-PB | 1..168 | 1..168 | 846 | 100 | Plus |
Pfdn5-PA | 168 | CG7048-PA | 1..168 | 1..168 | 846 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21980-PA | 168 | GI21980-PA | 1..154 | 1..154 | 716 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24222-PA | 168 | GL24222-PA | 1..154 | 1..154 | 728 | 87.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20058-PA | 168 | GA20058-PA | 1..154 | 1..154 | 733 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26439-PA | 168 | GM26439-PA | 1..168 | 1..168 | 874 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20958-PA | 168 | GD20958-PA | 1..168 | 1..168 | 874 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14341-PA | 168 | GJ14341-PA | 1..147 | 1..147 | 709 | 87.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12815-PA | 167 | GK12815-PA | 1..146 | 1..146 | 691 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10307-PA | 168 | GE10307-PA | 1..168 | 1..168 | 791 | 88.7 | Plus |