Clone GM15510 Report

Search the DGRC for GM15510

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:155
Well:10
Vector:pOT2
Associated Gene/TranscriptCG30154-RA
Protein status:GM15510.pep: gold
Sequenced Size:501

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18067 2002-01-01 Sim4 clustering to Release 2
CG30154 2003-01-01 Sim4 clustering to Release 3
CG18067 2008-04-29 Stopped prior to 5.5
CG30154 2008-04-29 Stopped prior to 5.5
CG30154-RA 2009-01-21 est gleaning

Clone Sequence Records

GM15510.complete Sequence

501 bp assembled on 2010-01-18

GenBank Submission: BT120142.1

> GM15510.complete
GAACTCCTCGGCTTGATCATGTACCTACGTCAACAACTCTGGGTTCTCTT
GCTCTGGCTCTGCTTCGTCGTTCTCAGCGTGCATGGCATGCCGTGGAAAT
GGGGACCTGCCTCCAATTCTGGACCCCATGGCGGACCCGCCTGGAATGGC
GGAGAAGAGTCCACCGACAATATAGTCATCCATTCGAAAAACAGCGGCAA
GTGGCGTTACTAAATTTATCCAAGTGGCAGAGGCGTGACCACAACCAAGT
CAAGCTGGATTTTACAGTAAATTTGTGAATAATTTTACAACTACTTTGCT
TCGCAATTGATTTTCGTCGAACAGTACTCGATTTGTATGCTAATACTTCA
TTCATGGTCACACTCACTTATATAGTCACTTTAATTGTGCACCTTTTTAT
CTATGACATTTAAATATAACCCTTTACTATACTGTATGTAATAGAGCCAA
AATATTTAAACGAGATTAAAAGCCTAATATTGCAAAAAAAAAAAAAAAAA
A

GM15510.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG30154-RA 772 CG30154-RA 200..687 1..486 2385 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16420286..16420692 79..483 1970 99.5 Plus
chr2R 21145070 chr2R 16420139..16420217 1..79 365 97.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:24:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20533521..20533930 79..486 1985 99.5 Plus
2R 25286936 2R 20533374..20533452 1..79 395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20534720..20535129 79..486 1995 99.5 Plus
2R 25260384 2R 20534573..20534651 1..79 395 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:58:44 has no hits.

GM15510.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:59:40 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16420139..16420217 1..79 97 -> Plus
chr2R 16420287..16420692 80..483 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-18 09:50:46 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 1..195 19..213 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:56 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 1..195 19..213 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:47:09 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 1..195 19..213 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:27:25 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 1..195 19..213 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:55 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 1..485 1..483 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:47:09 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 17..501 1..483 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:27:25 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 16..500 1..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:40 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20533374..20533452 1..79 100 -> Plus
2R 20533522..20533927 80..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:40 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20533374..20533452 1..79 100 -> Plus
2R 20533522..20533927 80..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:40 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20533374..20533452 1..79 100 -> Plus
2R 20533522..20533927 80..483 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:47:09 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16420879..16420957 1..79 100 -> Plus
arm_2R 16421027..16421432 80..483 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:29:11 Download gff for GM15510.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20534721..20535126 80..483 99   Plus
2R 20534573..20534651 1..79 100 -> Plus

GM15510.pep Sequence

Translation from 0 to 212

> GM15510.pep
ELLGLIMYLRQQLWVLLLWLCFVVLSVHGMPWKWGPASNSGPHGGPAWNG
GEESTDNIVIHSKNSGKWRY*

GM15510.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12270-PA 65 GF12270-PA 1..65 7..70 223 66.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22038-PA 63 GG22038-PA 1..63 7..70 234 89.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21070-PA 63 GH21070-PA 18..63 24..70 142 60.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG30154-PA 64 CG30154-PA 1..64 7..70 373 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22022-PA 64 GM22022-PA 1..64 7..70 271 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11520-PA 64 GD11520-PA 1..64 7..70 262 92.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21686-PA 65 GJ21686-PA 20..65 26..70 137 60.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19305-PA 62 GK19305-PA 1..62 7..70 170 56.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12118-PA 64 GE12118-PA 1..64 7..70 261 87.5 Plus

GM15510.hyp Sequence

Translation from 2 to 277

> GM15510.hyp
TPRLDHVPTSTTLGSLALALLRRSQRAWHAVEMGTCLQFWTPWRTRLEWR
RRVHRQYSHPFEKQRQVALLNLSKWQRRDHNQVKLDFTVNL*
Sequence GM15510.hyp has no blast hits.