GM15510.complete Sequence
501 bp assembled on 2010-01-18
GenBank Submission: BT120142.1
> GM15510.complete
GAACTCCTCGGCTTGATCATGTACCTACGTCAACAACTCTGGGTTCTCTT
GCTCTGGCTCTGCTTCGTCGTTCTCAGCGTGCATGGCATGCCGTGGAAAT
GGGGACCTGCCTCCAATTCTGGACCCCATGGCGGACCCGCCTGGAATGGC
GGAGAAGAGTCCACCGACAATATAGTCATCCATTCGAAAAACAGCGGCAA
GTGGCGTTACTAAATTTATCCAAGTGGCAGAGGCGTGACCACAACCAAGT
CAAGCTGGATTTTACAGTAAATTTGTGAATAATTTTACAACTACTTTGCT
TCGCAATTGATTTTCGTCGAACAGTACTCGATTTGTATGCTAATACTTCA
TTCATGGTCACACTCACTTATATAGTCACTTTAATTGTGCACCTTTTTAT
CTATGACATTTAAATATAACCCTTTACTATACTGTATGTAATAGAGCCAA
AATATTTAAACGAGATTAAAAGCCTAATATTGCAAAAAAAAAAAAAAAAA
A
GM15510.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:34:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30154-RA | 772 | CG30154-RA | 200..687 | 1..486 | 2385 | 99.5 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:58:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 16420286..16420692 | 79..483 | 1970 | 99.5 | Plus |
chr2R | 21145070 | chr2R | 16420139..16420217 | 1..79 | 365 | 97.5 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:24:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20533521..20533930 | 79..486 | 1985 | 99.5 | Plus |
2R | 25286936 | 2R | 20533374..20533452 | 1..79 | 395 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 20534720..20535129 | 79..486 | 1995 | 99.5 | Plus |
2R | 25260384 | 2R | 20534573..20534651 | 1..79 | 395 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 02:58:44 has no hits.
GM15510.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:59:40 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 16420139..16420217 | 1..79 | 97 | -> | Plus |
chr2R | 16420287..16420692 | 80..483 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-18 09:50:46 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30154-RA | 1..195 | 19..213 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:56 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30154-RA | 1..195 | 19..213 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:47:09 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30154-RA | 1..195 | 19..213 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:27:25 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30154-RA | 1..195 | 19..213 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:55 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30154-RA | 1..485 | 1..483 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:47:09 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30154-RA | 17..501 | 1..483 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:27:25 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30154-RA | 16..500 | 1..483 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:40 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20533374..20533452 | 1..79 | 100 | -> | Plus |
2R | 20533522..20533927 | 80..483 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:40 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20533374..20533452 | 1..79 | 100 | -> | Plus |
2R | 20533522..20533927 | 80..483 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:40 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20533374..20533452 | 1..79 | 100 | -> | Plus |
2R | 20533522..20533927 | 80..483 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:47:09 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16420879..16420957 | 1..79 | 100 | -> | Plus |
arm_2R | 16421027..16421432 | 80..483 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:29:11 Download gff for
GM15510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20534721..20535126 | 80..483 | 99 | | Plus |
2R | 20534573..20534651 | 1..79 | 100 | -> | Plus |
GM15510.pep Sequence
Translation from 0 to 212
> GM15510.pep
ELLGLIMYLRQQLWVLLLWLCFVVLSVHGMPWKWGPASNSGPHGGPAWNG
GEESTDNIVIHSKNSGKWRY*
GM15510.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:28:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12270-PA | 65 | GF12270-PA | 1..65 | 7..70 | 223 | 66.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:28:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22038-PA | 63 | GG22038-PA | 1..63 | 7..70 | 234 | 89.1 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:28:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH21070-PA | 63 | GH21070-PA | 18..63 | 24..70 | 142 | 60.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30154-PA | 64 | CG30154-PA | 1..64 | 7..70 | 373 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:28:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM22022-PA | 64 | GM22022-PA | 1..64 | 7..70 | 271 | 95.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:28:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11520-PA | 64 | GD11520-PA | 1..64 | 7..70 | 262 | 92.2 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:28:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ21686-PA | 65 | GJ21686-PA | 20..65 | 26..70 | 137 | 60.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:28:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19305-PA | 62 | GK19305-PA | 1..62 | 7..70 | 170 | 56.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:28:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12118-PA | 64 | GE12118-PA | 1..64 | 7..70 | 261 | 87.5 | Plus |
GM15510.hyp Sequence
Translation from 2 to 277
> GM15510.hyp
TPRLDHVPTSTTLGSLALALLRRSQRAWHAVEMGTCLQFWTPWRTRLEWR
RRVHRQYSHPFEKQRQVALLNLSKWQRRDHNQVKLDFTVNL*
Sequence GM15510.hyp has no blast hits.