BDGP Sequence Production Resources |
Search the DGRC for GM15762
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 157 |
Well: | 62 |
Vector: | pOT2 |
Associated Gene/Transcript | RpL23-RA |
Protein status: | GM15762.pep: gold |
Sequenced Size: | 522 |
Gene | Date | Evidence |
---|---|---|
RpL23 | 2008-12-18 | 5.12 accounting |
522 bp assembled on 2008-12-08
GenBank Submission: BT053700.1
> GM15762.complete TAATCTTGGAATAACCAGTCCGCGAGCAGCAAAATGTCGAAGAGAGGACG TGGAGGTACCGCGGGAGGCAAGTTCCGCATCTCCCTCGGTTTGCCCGTGG GCGCCGTGATGAACTGTGCCGACAACACCGGAGCCAAGAACCTGTACGTG ATCGCCGTCCACGGAATCCGCGGTCGCCTTAACCGTCTGCCCGCCGCTGG TGTCGGCGACATGTTCGTGGCCACCGTGAAGAAGGGAAAGCCCGAGCTCA GGAAGAAGGTCATGCCTGCCGTGGTTATTCGGCAGCGCAAACCGTTCAGG AGGAGGGACGGGGTGTTTATATACTTTGAGGACAATGCCGGGGTAATAGT AAACAACAAGGGCGAAATGAAGGGCTCGGCCATCACTGGACCGGTGGCCA AGGAATGCGCCGATCTGTGGCCCCGTATTGCATCCAATGCAAGCTCTATA GCCTAAGGAGTTTCCTTTTCAATAAACCCACAACGGAAAACAGATTGTTT TGAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 18742001..18742246 | 257..502 | 1230 | 100 | Plus |
chr2R | 21145070 | chr2R | 18741202..18741417 | 45..260 | 1080 | 100 | Plus |
chr2R | 21145070 | chr2R | 18741041..18741087 | 1..47 | 235 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 22855443..22855690 | 257..504 | 1240 | 100 | Plus |
2R | 25286936 | 2R | 22854645..22854860 | 45..260 | 1080 | 100 | Plus |
2R | 25286936 | 2R | 22854484..22854530 | 1..47 | 220 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 22856642..22856889 | 257..504 | 1240 | 100 | Plus |
2R | 25260384 | 2R | 22855844..22856059 | 45..260 | 1080 | 100 | Plus |
2R | 25260384 | 2R | 22855683..22855729 | 1..47 | 220 | 97.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 18741041..18741086 | 1..46 | 100 | -> | Plus |
chr2R | 18741204..18741415 | 47..258 | 100 | -> | Plus |
chr2R | 18742003..18742246 | 259..502 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL23-RA | 1..423 | 34..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL23-RA | 1..423 | 34..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL23-RA | 1..423 | 34..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL23-RA | 1..423 | 34..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL23-RA | 40..541 | 1..502 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL23-RA | 43..544 | 1..502 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL23-RA | 35..536 | 1..502 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL23-RA | 35..536 | 1..502 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22854484..22854529 | 1..46 | 97 | -> | Plus |
2R | 22854647..22854858 | 47..258 | 100 | -> | Plus |
2R | 22855445..22855688 | 259..502 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22854484..22854529 | 1..46 | 97 | -> | Plus |
2R | 22854647..22854858 | 47..258 | 100 | -> | Plus |
2R | 22855445..22855688 | 259..502 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22854484..22854529 | 1..46 | 97 | -> | Plus |
2R | 22854647..22854858 | 47..258 | 100 | -> | Plus |
2R | 22855445..22855688 | 259..502 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 18742007..18742052 | 1..46 | 97 | -> | Plus |
arm_2R | 18742170..18742381 | 47..258 | 100 | -> | Plus |
arm_2R | 18742968..18743211 | 259..502 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22855864..22856075 | 47..258 | 100 | -> | Plus |
2R | 22856662..22856905 | 259..502 | 100 | Plus | |
2R | 22855701..22855746 | 1..46 | 97 | -> | Plus |
Translation from 33 to 455
> GM15762.pep MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLN RLPAAGVGDMFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFED NAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNASSIA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13548-PA | 140 | GF13548-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22807-PA | 140 | GG22807-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21796-PA | 140 | GH21796-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL23-PA | 140 | CG3661-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20545-PA | 140 | GI20545-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10129-PA | 140 | GL10129-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17595-PA | 140 | GA17595-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15964-PA | 140 | GM15964-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11716-PA | 140 | GD11716-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22396-PA | 140 | GJ22396-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20786-PA | 140 | GK20786-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpL23-PA | 140 | GE14240-PA | 1..140 | 1..140 | 719 | 100 | Plus |
Translation from 33 to 455
> GM15762.hyp MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLN RLPAAGVGDMFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFED NAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNASSIA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL23-PA | 140 | CG3661-PA | 1..140 | 1..140 | 719 | 100 | Plus |