Clone GM15762 Report

Search the DGRC for GM15762

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:157
Well:62
Vector:pOT2
Associated Gene/TranscriptRpL23-RA
Protein status:GM15762.pep: gold
Sequenced Size:522

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpL23 2008-12-18 5.12 accounting

Clone Sequence Records

GM15762.complete Sequence

522 bp assembled on 2008-12-08

GenBank Submission: BT053700.1

> GM15762.complete
TAATCTTGGAATAACCAGTCCGCGAGCAGCAAAATGTCGAAGAGAGGACG
TGGAGGTACCGCGGGAGGCAAGTTCCGCATCTCCCTCGGTTTGCCCGTGG
GCGCCGTGATGAACTGTGCCGACAACACCGGAGCCAAGAACCTGTACGTG
ATCGCCGTCCACGGAATCCGCGGTCGCCTTAACCGTCTGCCCGCCGCTGG
TGTCGGCGACATGTTCGTGGCCACCGTGAAGAAGGGAAAGCCCGAGCTCA
GGAAGAAGGTCATGCCTGCCGTGGTTATTCGGCAGCGCAAACCGTTCAGG
AGGAGGGACGGGGTGTTTATATACTTTGAGGACAATGCCGGGGTAATAGT
AAACAACAAGGGCGAAATGAAGGGCTCGGCCATCACTGGACCGGTGGCCA
AGGAATGCGCCGATCTGTGGCCCCGTATTGCATCCAATGCAAGCTCTATA
GCCTAAGGAGTTTCCTTTTCAATAAACCCACAACGGAAAACAGATTGTTT
TGAAAAAAAAAAAAAAAAAAAA

GM15762.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
RpL23-RA 588 RpL23-RA 68..571 1..504 2505 99.8 Plus
RpL23.a 469 RpL23.a 189..461 232..504 1365 100 Plus
RpL23.a 469 RpL23.a 33..188 1..156 765 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18742001..18742246 257..502 1230 100 Plus
chr2R 21145070 chr2R 18741202..18741417 45..260 1080 100 Plus
chr2R 21145070 chr2R 18741041..18741087 1..47 235 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:24:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22855443..22855690 257..504 1240 100 Plus
2R 25286936 2R 22854645..22854860 45..260 1080 100 Plus
2R 25286936 2R 22854484..22854530 1..47 220 97.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22856642..22856889 257..504 1240 100 Plus
2R 25260384 2R 22855844..22856059 45..260 1080 100 Plus
2R 25260384 2R 22855683..22855729 1..47 220 97.8 Plus
Blast to na_te.dros performed on 2019-03-16 03:02:50 has no hits.

GM15762.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:03:39 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18741041..18741086 1..46 100 -> Plus
chr2R 18741204..18741415 47..258 100 -> Plus
chr2R 18742003..18742246 259..502 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:34 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23-RA 1..423 34..456 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:16 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23-RA 1..423 34..456 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:28 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23-RA 1..423 34..456 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:29:10 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23-RA 1..423 34..456 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-08 12:49:09 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23-RA 40..541 1..502 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:16 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23-RA 43..544 1..502 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:28 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23-RA 35..536 1..502 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:29:10 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23-RA 35..536 1..502 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:39 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22854484..22854529 1..46 97 -> Plus
2R 22854647..22854858 47..258 100 -> Plus
2R 22855445..22855688 259..502 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:39 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22854484..22854529 1..46 97 -> Plus
2R 22854647..22854858 47..258 100 -> Plus
2R 22855445..22855688 259..502 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:39 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22854484..22854529 1..46 97 -> Plus
2R 22854647..22854858 47..258 100 -> Plus
2R 22855445..22855688 259..502 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:28 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18742007..18742052 1..46 97 -> Plus
arm_2R 18742170..18742381 47..258 100 -> Plus
arm_2R 18742968..18743211 259..502 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:52:52 Download gff for GM15762.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22855864..22856075 47..258 100 -> Plus
2R 22856662..22856905 259..502 100   Plus
2R 22855701..22855746 1..46 97 -> Plus

GM15762.pep Sequence

Translation from 33 to 455

> GM15762.pep
MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLN
RLPAAGVGDMFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFED
NAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNASSIA*

GM15762.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13548-PA 140 GF13548-PA 1..140 1..140 719 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22807-PA 140 GG22807-PA 1..140 1..140 719 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21796-PA 140 GH21796-PA 1..140 1..140 719 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
RpL23-PA 140 CG3661-PA 1..140 1..140 719 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20545-PA 140 GI20545-PA 1..140 1..140 719 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10129-PA 140 GL10129-PA 1..140 1..140 719 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17595-PA 140 GA17595-PA 1..140 1..140 719 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15964-PA 140 GM15964-PA 1..140 1..140 719 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11716-PA 140 GD11716-PA 1..140 1..140 719 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22396-PA 140 GJ22396-PA 1..140 1..140 719 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20786-PA 140 GK20786-PA 1..140 1..140 719 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL23-PA 140 GE14240-PA 1..140 1..140 719 100 Plus

GM15762.hyp Sequence

Translation from 33 to 455

> GM15762.hyp
MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLN
RLPAAGVGDMFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFED
NAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNASSIA*

GM15762.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
RpL23-PA 140 CG3661-PA 1..140 1..140 719 100 Plus