Clone GM15778 Report

Search the DGRC for GM15778

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:157
Well:78
Vector:pOT2
Associated Gene/TranscriptRpL29-RA
Protein status:GM15778.pep: gold
Sequenced Size:331

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpL29 2008-12-18 5.12 accounting

Clone Sequence Records

GM15778.complete Sequence

331 bp assembled on 2008-12-08

GenBank Submission: BT053701.1

> GM15778.complete
GAATTCCAGTGTGCGAAAAACTTTAAGATGGCCAAGTCCAAGAACCACAC
AAATCACAACCAGAACAAGAAGGCCCATCGTAATGGCATCAAGCGCCCGC
TGCGCAAACGCCACGAGTCCACTCTGGGTATGGATGTGAAATTCCTGATC
AACCAGCGCTACGCACGCAAGGGAAACCTTTCCCGCGAGGAGTCCGTGAA
GCGCTACAACGAGCGCATCGCTTCCCAGAAGGGCAAGCCAAAGCCTGTTA
CTCTGTAGATGATTGCCCCGCGTGTGGATAATTAAAGGACAATTCAGTTT
AACAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GM15778.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
RpL29-RB 492 RpL29-RB 87..392 1..306 1515 99.6 Plus
RpL29-RC 492 RpL29-RC 87..392 1..306 1515 99.6 Plus
RpL29-RA 570 RpL29-RA 165..470 1..306 1515 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17180711..17180884 130..303 870 100 Plus
chr2R 21145070 chr2R 17180534..17180641 22..129 540 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:24:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21294231..21294407 130..306 870 99.4 Plus
2R 25286936 2R 21294054..21294161 22..129 540 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21295430..21295606 130..306 870 99.4 Plus
2R 25260384 2R 21295253..21295360 22..129 540 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:50:52 has no hits.

GM15778.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:51:38 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17180334..17180354 1..21 100 -> Plus
chr2R 17180534..17180641 22..129 100 -> Plus
chr2R 17180711..17180884 130..303 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:59:39 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RC 1..231 28..258 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:17 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RC 1..231 28..258 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:10:00 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RA 1..231 28..258 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:20:18 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RA 1..231 28..258 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-08 15:37:13 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RB 72..374 1..303 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:17 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RB 72..374 1..303 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:10:00 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RA 27..329 1..303 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:18 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RA 27..329 1..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:38 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21294231..21294404 130..303 99   Plus
2R 21293854..21293874 1..21 100 -> Plus
2R 21294054..21294161 22..129 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:38 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21294231..21294404 130..303 99   Plus
2R 21293854..21293874 1..21 100 -> Plus
2R 21294054..21294161 22..129 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:38 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21294231..21294404 130..303 99   Plus
2R 21293854..21293874 1..21 100 -> Plus
2R 21294054..21294161 22..129 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:10:00 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17181559..17181666 22..129 100 -> Plus
arm_2R 17181359..17181379 1..21 100 -> Plus
arm_2R 17181736..17181909 130..303 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:52:54 Download gff for GM15778.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21295053..21295073 1..21 100 -> Plus
2R 21295253..21295360 22..129 100 -> Plus
2R 21295430..21295603 130..303 99   Plus

GM15778.pep Sequence

Translation from 0 to 257

> GM15778.pep
EFQCAKNFKMAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLI
NQRYARKGNLSREESVKRYNERIASQKGKPKPVTL*

GM15778.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12809-PA 76 GF12809-PA 1..76 10..85 369 93.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22107-PA 76 GG22107-PA 1..76 10..85 383 96.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20638-PA 76 GH20638-PA 1..76 10..85 363 90.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
RpL29-PD 76 CG10071-PD 1..76 10..85 396 100 Plus
RpL29-PB 76 CG10071-PB 1..76 10..85 396 100 Plus
RpL29-PA 76 CG10071-PA 1..76 10..85 396 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19001-PA 76 GI19001-PA 1..76 10..85 369 92.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11334-PA 76 GL11334-PA 1..76 10..85 381 93.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10049-PA 76 GA10049-PA 1..76 10..85 381 93.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15826-PA 76 GM15826-PA 1..76 10..85 392 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11583-PA 76 GD11583-PA 1..76 10..85 392 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19967-PA 76 GJ19967-PA 1..76 10..85 358 88.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21709-PA 76 GK21709-PA 1..76 10..85 376 94.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL29-PA 76 GE12188-PA 1..76 10..85 385 97.4 Plus

GM15778.hyp Sequence

Translation from 0 to 257

> GM15778.hyp
EFQCAKNFKMAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLI
NQRYARKGNLSREESVKRYNERIASQKGKPKPVTL*

GM15778.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
RpL29-PD 76 CG10071-PD 1..76 10..85 396 100 Plus
RpL29-PB 76 CG10071-PB 1..76 10..85 396 100 Plus
RpL29-PA 76 CG10071-PA 1..76 10..85 396 100 Plus