Clone GM16085 Report

Search the DGRC for GM16085

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:160
Well:85
Vector:pOT2
Associated Gene/TranscriptCG15014-RA
Protein status:GM16085.pep: gold
Preliminary Size:1008
Sequenced Size:1127

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15014 2002-01-01 Sim4 clustering to Release 2
CG15014 2002-06-04 Blastp of sequenced clone
CG15014 2003-01-01 Sim4 clustering to Release 3
CG15014 2008-04-29 Release 5.5 accounting
CG15014 2008-08-15 Release 5.9 accounting
CG15014 2008-12-18 5.12 accounting

Clone Sequence Records

GM16085.complete Sequence

1127 bp (1127 high quality bases) assembled on 2002-06-04

GenBank Submission: AY118476

> GM16085.complete
TTTTATTTCATGGAGCCCGCCTCAAAAAAATCGAAAATGGGTAAAAACGT
GAAGTTTAACAACAACAAGAAGAAGTATTTCCACGCCAAGAGGCAGACGC
TCCAACCTGGGCAACGTGGATTCTTCGCCACGTGCAACATCAACGAGAAG
GCATGTGTTCGCGAATGCTACAATTTGTTGAACCACTATGCTGACATACT
TTACGGTTCGGAAAAGCCAGAGAATGAACCGGAAAAGAAGCAGCCAGAGG
AAGGAGCGGGTGGTGATGCGGGAGAGGATGATCCGAAGCCAGCGGCGGGA
GGCACCAGTGATGACGATGACGACTTGGAAGCAGCTGCCGCCAAATGCCG
CGAGATGCTTTCGCAGCGCAAGATGCGATTCCAGAATGTAGACACCAACA
CCACCAACTGCGTGTTCATCCGCACCCAACTGGAGGATCCGGTCGCCCTG
GGTAAACACATCATCAACGACATAGCGACCACCGGCAAGTCCATGTCCCG
ATTTGTCCTGCGCCTGGTGCCCATCGAAGTCGTCTGCCGCGCCAACATGC
CGGACATCATCACTGCCGCCGGCGAGCTCTTCGACAAGCACTTCCTCAAG
GAGCCCACCAGCTATGGCATCATCTTCAATCATCGCTATAATCAGCAGAT
CAAGCGCGACCAAATCATAACCCAACTGGCCGAGCTGGTCAACTCCAAGA
ACGTGGGTAACAAGGTGGACCTAAAGGAGGCCAAGAAATCCATCATCGTG
GAGGTCTTGAGGGGCTGGTGTCTGCTTAGCGTGATCGACAACTATCTGGA
GTGCAAAAAGTTCAACCTGGCCGAGCTGGCCAATCCTAGCGATAAAAAAT
CTTCCGGCGAAGGAGATTCCAAGTCGGAGACTTCAGAGGTCGCCAATGGC
AACGATAAGGAGCAAGCTGAATCTTCAGAAGAGTCCAAGTCTAATGACGA
TGAGAATAAGGACTCTACTGAGAATGACAAATAAATGAAAATCAAAACCG
CCCAATTAAAGATATATAGCAATGACCACACCTAGGTATAGATGGACCAT
CTGCTGTGCAGACGAATATAAATAAAGCATCCAGTTATTATTTACTTCTG
TTAAAAAAAAAAAAAAAAAAAAAAAAA

GM16085.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15014-RA 1126 CG15014-RA 25..1126 1..1102 5510 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4320497..4321598 1102..1 5480 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:24:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4321103..4322206 1104..1 5520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4321103..4322206 1104..1 5520 100 Minus
Blast to na_te.dros performed 2019-03-16 20:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 568..680 899..1014 140 61.5 Plus

GM16085.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:21:54 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4320497..4321598 1..1102 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:35 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
CG15014-RA 1..975 10..984 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:33:08 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
CG15014-RA 1..975 10..984 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:53:52 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
CG15014-RA 1..975 10..984 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:24:34 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
CG15014-RA 1..975 10..984 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:59:50 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
CG15014-RA 1..975 10..984 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:03:56 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
CG15014-RA 25..1126 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:33:08 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
CG15014-RA 25..1126 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:53:52 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
CG15014-RA 54..1155 1..1102 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:24:34 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
CG15014-RA 25..1126 1..1102 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:59:50 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
CG15014-RA 54..1155 1..1102 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:54 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4321105..4322206 1..1102 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:54 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4321105..4322206 1..1102 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:54 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4321105..4322206 1..1102 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:53:52 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4321105..4322206 1..1102 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:57:10 Download gff for GM16085.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4321105..4322206 1..1102 100   Minus

GM16085.hyp Sequence

Translation from 0 to 983

> GM16085.hyp
FYFMEPASKKSKMGKNVKFNNNKKKYFHAKRQTLQPGQRGFFATCNINEK
ACVRECYNLLNHYADILYGSEKPENEPEKKQPEEGAGGDAGEDDPKPAAG
GTSDDDDDLEAAAAKCREMLSQRKMRFQNVDTNTTNCVFIRTQLEDPVAL
GKHIINDIATTGKSMSRFVLRLVPIEVVCRANMPDIITAAGELFDKHFLK
EPTSYGIIFNHRYNQQIKRDQIITQLAELVNSKNVGNKVDLKEAKKSIIV
EVLRGWCLLSVIDNYLECKKFNLAELANPSDKKSSGEGDSKSETSEVANG
NDKEQAESSEESKSNDDENKDSTENDK*

GM16085.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG15014-PA 324 CG15014-PA 1..324 4..327 1692 100 Plus

GM16085.pep Sequence

Translation from 9 to 983

> GM16085.pep
MEPASKKSKMGKNVKFNNNKKKYFHAKRQTLQPGQRGFFATCNINEKACV
RECYNLLNHYADILYGSEKPENEPEKKQPEEGAGGDAGEDDPKPAAGGTS
DDDDDLEAAAAKCREMLSQRKMRFQNVDTNTTNCVFIRTQLEDPVALGKH
IINDIATTGKSMSRFVLRLVPIEVVCRANMPDIITAAGELFDKHFLKEPT
SYGIIFNHRYNQQIKRDQIITQLAELVNSKNVGNKVDLKEAKKSIIVEVL
RGWCLLSVIDNYLECKKFNLAELANPSDKKSSGEGDSKSETSEVANGNDK
EQAESSEESKSNDDENKDSTENDK*

GM16085.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24737-PA 324 GF24737-PA 1..296 10..308 1192 76.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14193-PA 297 GG14193-PA 1..278 10..295 1282 90.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15424-PA 286 GH15424-PA 1..269 1..277 947 70.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15014-PA 324 CG15014-PA 1..324 1..324 1692 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13025-PA 298 GI13025-PA 1..279 1..293 1094 72.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16286-PA 280 GL16286-PA 1..271 10..319 932 62.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13433-PA 312 GA13433-PA 1..303 10..319 1107 71.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13983-PA 315 GM13983-PA 1..315 10..324 1464 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13265-PA 315 GD13265-PA 14..315 23..324 1397 93.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12121-PA 302 GJ12121-PA 13..290 23..322 949 63.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10901-PA 299 GK10901-PA 1..299 1..306 1065 72.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20623-PA 323 GE20623-PA 1..320 10..323 1253 83.9 Plus