Clone GM16138 Report

Search the DGRC for GM16138

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:161
Well:38
Vector:pOT2
Associated Gene/TranscriptCG40127-RA
Protein status:GM16138.pep: gold
Sequenced Size:472

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17676 2002-01-01 Sim4 clustering to Release 2
CG40127 2002-05-18 Blastp of sequenced clone
CG40127 2003-01-01 Sim4 clustering to Release 3
CG40127 2008-04-29 Release 5.5 accounting
CG40127 2008-08-15 Release 5.9 accounting
CG40127 2008-12-18 5.12 accounting

Clone Sequence Records

GM16138.complete Sequence

472 bp (472 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118852

> GM16138.complete
ACGAATTGTGTTTGCTGAAACTTTTTATTCTCTTAAAAGTGTTTAACAAA
AATTTAAGAAAATGAAAATCTGTGGCCCGAAACTATCACTTTGTGGTCTT
ATTATCTCTGTTTGGGGTATTGTCCAATTGGTTTTAATGGGTCTATTCTT
CTACATAAATAGTGTAGCCCTCATTGAGGACTTACCTCTTGAGGAGGAAT
ACCATTCGTTGGAAGATTTTTATGCAGCTGCAAATAGAGCATACAATCAG
AATGCCTACAACTGCTGGATTGCCGCATGTATATATGTTTTGACTTTGTT
GCTCTCCGCCCAGCAATTTTACATGAATAGCAGAGTAACTGCCAACTAAT
ATTTCAGATGTAGTTTCCCAACTACTTAAAACTAGTATTGAAATTTTCCC
TTCGATATATTTGTTAGAGGTGTTTTCCTTTTAATAAAGTTAAAGTTCAA
TTTAAAAAAAAAAAAAAAAAAA

GM16138.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG40127-RA 700 CG40127-RA 84..539 1..456 2280 100 Plus
CG40127.a 987 CG40127.a 84..539 1..456 2280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 75008..75213 453..248 1030 100 Minus
chr2R 21145070 chr2R 75462..75593 132..1 660 100 Minus
chr2R 21145070 chr2R 75278..75398 250..130 605 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:24:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4187487..4187696 456..247 1050 100 Minus
2R 25286936 2R 4187944..4188075 132..1 660 100 Minus
2R 25286936 2R 4187760..4187880 250..130 605 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 4188686..4188895 456..247 1050 100 Minus
2R 25260384 2R 4189143..4189274 132..1 660 100 Minus
2R 25260384 2R 4188959..4189079 250..130 605 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:56:54 has no hits.

GM16138.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:57:34 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 75008..75210 251..453 100 <- Minus
chr2R 75278..75397 131..250 100 <- Minus
chr2R 75464..75593 1..130 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:38 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RA 1..288 62..349 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:36 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RA 1..288 62..349 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:03:43 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RB 1..288 62..349 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:00 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RA 1..288 62..349 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:10:19 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RB 1..288 62..349 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:28 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RA 82..534 1..453 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:36 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RA 82..534 1..453 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:03:43 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RB 53..505 1..453 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:00 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RA 82..534 1..453 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:10:19 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RB 53..505 1..453 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:34 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4187490..4187692 251..453 100 <- Minus
2R 4187760..4187879 131..250 100 <- Minus
2R 4187946..4188075 1..130 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:34 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4187490..4187692 251..453 100 <- Minus
2R 4187760..4187879 131..250 100 <- Minus
2R 4187946..4188075 1..130 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:34 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4187490..4187692 251..453 100 <- Minus
2R 4187760..4187879 131..250 100 <- Minus
2R 4187946..4188075 1..130 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:03:43 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 74995..75197 251..453 100 <- Minus
arm_2R 75265..75384 131..250 100 <- Minus
arm_2R 75451..75580 1..130 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:02 Download gff for GM16138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4188689..4188891 251..453 100 <- Minus
2R 4188959..4189078 131..250 100 <- Minus
2R 4189145..4189274 1..130 100   Minus

GM16138.pep Sequence

Translation from 61 to 348

> GM16138.pep
MKICGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSL
EDFYAAANRAYNQNAYNCWIAACIYVLTLLLSAQQFYMNSRVTAN*

GM16138.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13846-PA 95 GF13846-PA 1..95 1..95 481 95.8 Plus
Dana\GF11647-PA 110 GF11647-PA 2..83 3..82 164 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21385-PA 95 GG21385-PA 1..95 1..95 495 100 Plus
Dere\GG22165-PA 103 GG22165-PA 3..75 4..76 148 35.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20457-PA 95 GH20457-PA 1..95 1..95 452 91.6 Plus
Dgri\GH20554-PA 107 GH20554-PA 4..83 3..82 173 42.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
RNASEK-PA 95 CG40127-PA 1..95 1..95 497 100 Plus
RNASEK-PB 95 CG40127-PB 1..95 1..95 497 100 Plus
CG11269-PA 107 CG11269-PA 3..75 4..76 156 41.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18882-PA 95 GI18882-PA 1..95 1..95 383 90.5 Plus
Dmoj\GI18823-PA 112 GI18823-PA 3..81 4..82 179 45.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11056-PA 95 GL11056-PA 1..95 1..95 492 98.9 Plus
Dper\GL11780-PA 102 GL11780-PA 2..81 3..82 205 48.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24591-PA 95 GA24591-PA 1..95 1..95 492 98.9 Plus
Dpse\GA10879-PA 102 GA10879-PA 2..81 3..82 205 48.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11704-PA 95 GM11704-PA 1..95 1..95 495 100 Plus
Dsec\GM15886-PA 107 GM15886-PA 2..75 3..76 164 41.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17680-PA 95 GD17680-PA 1..95 1..95 495 100 Plus
Dsim\GD11649-PA 107 GD11649-PA 2..75 3..76 164 41.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21916-PA 95 GJ21916-PA 1..95 1..95 453 91.6 Plus
Dvir\GJ21850-PA 108 GJ21850-PA 4..76 3..75 168 39.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10758-PA 95 GK10758-PA 1..95 1..95 479 95.8 Plus
Dwil\GK19636-PA 134 GK19636-PA 2..80 3..81 206 45.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22683-PA 95 GE22683-PA 1..95 1..95 495 100 Plus
Dyak\GE14158-PA 105 GE14158-PA 2..81 3..82 178 42.5 Plus

GM16138.hyp Sequence

Translation from 61 to 348

> GM16138.hyp
MKICGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSL
EDFYAAANRAYNQNAYNCWIAACIYVLTLLLSAQQFYMNSRVTAN*

GM16138.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG40127-PA 95 CG40127-PA 1..95 1..95 497 100 Plus
CG40127-PB 95 CG40127-PB 1..95 1..95 497 100 Plus
CG11269-PA 107 CG11269-PA 3..75 4..76 156 41.1 Plus