BDGP Sequence Production Resources |
Search the DGRC for GM16226
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 162 |
Well: | 26 |
Vector: | pOT2 |
Associated Gene/Transcript | CG10343-RA |
Protein status: | GM16226.pep: gold |
Preliminary Size: | 729 |
Sequenced Size: | 874 |
Gene | Date | Evidence |
---|---|---|
CG10343 | 2002-01-01 | Sim4 clustering to Release 2 |
CG10343 | 2002-06-04 | Blastp of sequenced clone |
CG10343 | 2003-01-01 | Sim4 clustering to Release 3 |
CG10343 | 2008-04-29 | Release 5.5 accounting |
CG10343 | 2008-08-15 | Release 5.9 accounting |
CG10343 | 2008-12-18 | 5.12 accounting |
874 bp (874 high quality bases) assembled on 2002-06-04
GenBank Submission: AY118478
> GM16226.complete TGTTTTTGTTACAAATTTTGATTTTTGTCTTGTTTAACCAAAAATGATAA AATCTTGAACAGTAAAGATAATCCACACAATTTACTATGAGCACGCCACT GGAACAGCAGACGGAAGAACGGGAGGCGTTGCAGTCAATATACGAGGGCG ACACGAACTTCAAGGAAATAGATAGCGTCACATTTCAGTACAAATATGGC GAAGAGGATAACTACAAGTCGTTCTTGGTCGAGCTCAAGTGGGGCGAAAA TTACCCCGATGAGGCGCCAGCGATCAACATGAACGCGTTTTACAATAGGA ATCTACTGCCAGCTGTCAAGGAAGGGATCCAAACGGCTCTGAGTACGGAA GCGGACCAATGGCTGGGCTGTGGCATGACCTATACCCTGTTCGAATGCCT TAAGGACAACCTGGAGCAATTGACCGCAGAGCAACCCGAATCTGCACCCA CGGTGGCGTTAGTGGATGATGGCGTGGGTGCTCTAAAGATCTCCGATCCC AATGCCGATGCGGAGTCCAAGAAAAAGGAGCCCAAGAAGGAGCACCTGAC TAAGGCGCAAAAGCGCCGGCAGTGGGAGAGAACCGATCACAAAGGAGACC GGGAACGTGGCTGGGATTGGGTGGACCTCGTCAAGCATTTATCGCAGACG GGTGGGAAAAACGATGATTCTCTCACTGCCGCCGAAATTGCAGCGTCCAA CGCTCCAGCTCTCCACCCCCTGAACAACTAAAATGCCTACCAACTAAAAA TAGGAGTAATAACATCGAGGAAACCTTAAATTGAAATCAAAAGCCAATAC TATTTTATGTGATAGAATAAACGCGAGTAACTGCATGGGCGGCTATCATA AAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 18702655..18703199 | 305..849 | 2725 | 100 | Plus |
chr2L | 23010047 | chr2L | 18702212..18702405 | 1..194 | 955 | 99.5 | Plus |
chr2L | 23010047 | chr2L | 18702473..18702582 | 195..304 | 550 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18703910..18704457 | 305..852 | 2740 | 100 | Plus |
2L | 23513712 | 2L | 18703467..18703660 | 1..194 | 955 | 99.5 | Plus |
2L | 23513712 | 2L | 18703728..18703837 | 195..304 | 550 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18703910..18704457 | 305..852 | 2740 | 100 | Plus |
2L | 23513712 | 2L | 18703467..18703660 | 1..194 | 955 | 99.4 | Plus |
2L | 23513712 | 2L | 18703728..18703837 | 195..304 | 550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 18702212..18702405 | 1..194 | 99 | -> | Plus |
chr2L | 18702473..18702582 | 195..304 | 100 | -> | Plus |
chr2L | 18702655..18703199 | 305..849 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10343-RA | 1..645 | 87..731 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10343-RA | 1..645 | 87..731 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10343-RA | 1..645 | 87..731 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10343-RA | 1..645 | 87..731 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10343-RA | 1..645 | 87..731 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10343-RA | 1..849 | 1..849 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10343-RA | 1..849 | 1..849 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10343-RA | 1..843 | 7..849 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10343-RA | 1..849 | 1..849 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10343-RA | 1..843 | 7..849 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18703467..18703660 | 1..194 | 99 | -> | Plus |
2L | 18703728..18703837 | 195..304 | 100 | -> | Plus |
2L | 18703910..18704454 | 305..849 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18703467..18703660 | 1..194 | 99 | -> | Plus |
2L | 18703728..18703837 | 195..304 | 100 | -> | Plus |
2L | 18703910..18704454 | 305..849 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18703467..18703660 | 1..194 | 99 | -> | Plus |
2L | 18703728..18703837 | 195..304 | 100 | -> | Plus |
2L | 18703910..18704454 | 305..849 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 18703467..18703660 | 1..194 | 99 | -> | Plus |
arm_2L | 18703728..18703837 | 195..304 | 100 | -> | Plus |
arm_2L | 18703910..18704454 | 305..849 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18703910..18704454 | 305..849 | 100 | Plus | |
2L | 18703467..18703660 | 1..194 | 99 | -> | Plus |
2L | 18703728..18703837 | 195..304 | 100 | -> | Plus |
Translation from 86 to 730
> GM16226.hyp MSTPLEQQTEEREALQSIYEGDTNFKEIDSVTFQYKYGEEDNYKSFLVEL KWGENYPDEAPAINMNAFYNRNLLPAVKEGIQTALSTEADQWLGCGMTYT LFECLKDNLEQLTAEQPESAPTVALVDDGVGALKISDPNADAESKKKEPK KEHLTKAQKRRQWERTDHKGDRERGWDWVDLVKHLSQTGGKNDDSLTAAE IAASNAPALHPLNN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10343-PA | 214 | CG10343-PA | 1..214 | 1..214 | 1135 | 100 | Plus |
Translation from 86 to 730
> GM16226.pep MSTPLEQQTEEREALQSIYEGDTNFKEIDSVTFQYKYGEEDNYKSFLVEL KWGENYPDEAPAINMNAFYNRNLLPAVKEGIQTALSTEADQWLGCGMTYT LFECLKDNLEQLTAEQPESAPTVALVDDGVGALKISDPNADAESKKKEPK KEHLTKAQKRRQWERTDHKGDRERGWDWVDLVKHLSQTGGKNDDSLTAAE IAASNAPALHPLNN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15069-PA | 210 | GF15069-PA | 1..210 | 1..214 | 929 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21128-PA | 214 | GG21128-PA | 1..214 | 1..214 | 1030 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11608-PA | 214 | GH11608-PA | 1..213 | 1..213 | 893 | 80.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10343-PA | 214 | CG10343-PA | 1..214 | 1..214 | 1135 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17912-PA | 214 | GI17912-PA | 1..213 | 1..213 | 891 | 79.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19632-PA | 213 | GL19632-PA | 2..213 | 3..214 | 862 | 75.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10259-PA | 213 | GA10259-PA | 2..213 | 3..214 | 862 | 75.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17289-PA | 214 | GM17289-PA | 1..214 | 1..214 | 1142 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24152-PA | 214 | GD24152-PA | 1..214 | 1..214 | 1137 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17683-PA | 214 | GJ17683-PA | 1..213 | 1..213 | 904 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24690-PA | 209 | GK24690-PA | 1..208 | 1..213 | 824 | 72.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13202-PA | 214 | GE13202-PA | 1..214 | 1..214 | 1093 | 94.9 | Plus |