BDGP Sequence Production Resources |
Search the DGRC for GM16372
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 163 |
Well: | 72 |
Vector: | pOT2 |
Associated Gene/Transcript | CG7339-RA |
Protein status: | GM16372.pep: gold |
Preliminary Size: | 963 |
Sequenced Size: | 953 |
Gene | Date | Evidence |
---|---|---|
CG7339 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7339 | 2002-06-04 | Blastp of sequenced clone |
CG7339 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7339 | 2008-04-29 | Release 5.5 accounting |
CG7339 | 2008-08-15 | Release 5.9 accounting |
CG7339 | 2008-12-18 | 5.12 accounting |
953 bp (953 high quality bases) assembled on 2002-06-04
GenBank Submission: AY118479
> GM16372.complete AAAACAATGAACGAGCATTAGTTTAAAAGAAGATATTTAAACAATTTGGC GACATGTTCGTGCTGGCGGAGCTGAAGGACAATGTGAGGATTGCGCCGGA CCAGTTCCATCTGAAGTTGGTGGACGCCGTGCGCGACGAGATCGACCGAA AGCTGGCCAATAAGGTCCTTCTTAACGTGGGATTATGCATTGCGCTGAAG GATATTGTTTCACTGAAGGATTCCATCATCCTGCCGGGAGACGGAGCCTC GCACACGGAGGTTCTGTTCCGGTACGTGGTCTTCCGGCCGATGGTGGGCA CCGTGATTACCGGAAAGATTCGAAACTGCAGCCGCGAAGGAGTCCATGTG ACACTTGGTTTCTTCGACGACATCCTCATTCCGCATGCCGCCCTGCAGCA TCCTTCGCGCTTCGATGAGGCCGAACAGGCCTGGGTTTGGGAATATCCGC TCGAGGACGGCGCCAAACACGATCTCTTCATGGACGTTGGCGAGCCCATC AAGTTCCGCGTATCACGGGAGATCTTCGAGGAAACATCACCCATTGGACC ACCGAAAACTGAGGCTCAGACTCAGCAGGGAGCTAGCACATCCGCTGCAG TCGCATCAGCTACCTCCCAAGAAGTGAAGACACCGTACAGGATTATTGGC GCCATTAACGAATCCGGCCTAGGCGTGCTCTCCTGGTGGGATCAGCAGGG AAAGGACGATGAGCAGGACGACGAGGAGGACGAGGAGTACGATGACGAAG ATGGCGAAGGCGCATGCGAAGAATGATCCTGACGCCTACTCCTTTGTATA GATGCCACTTACATTAGGGTTAGGAATTCGATTTAAGATGAAGTCATGAC TATAAAGTTTGATTTAAGTCTGATTAGATCACAGCGTGTTTATGATTTCC AGACCATACCATACCATAAAAACACAATTAAATTCAAAAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 11639922..11640407 | 163..648 | 2430 | 100 | Plus |
chr3L | 24539361 | chr3L | 11640469..11640749 | 651..935 | 1330 | 98.6 | Plus |
chr3L | 24539361 | chr3L | 11639703..11639868 | 1..166 | 830 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 11649007..11649492 | 163..648 | 2385 | 99.4 | Plus |
3L | 28110227 | 3L | 11649554..11649839 | 651..936 | 1385 | 99 | Plus |
3L | 28110227 | 3L | 11648788..11648953 | 1..166 | 830 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 11642107..11642592 | 163..648 | 2385 | 99.3 | Plus |
3L | 28103327 | 3L | 11642654..11642939 | 651..936 | 1385 | 98.9 | Plus |
3L | 28103327 | 3L | 11641888..11642053 | 1..166 | 830 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 11639703..11639866 | 1..164 | 100 | -> | Plus |
chr3L | 11639924..11640406 | 165..647 | 100 | -> | Plus |
chr3L | 11640466..11640749 | 648..935 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7339-RA | 1..723 | 54..776 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7339-RA | 1..723 | 54..776 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7339-RA | 1..723 | 54..776 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7339-RA | 1..723 | 54..776 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7339-RA | 1..723 | 54..776 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7339-RA | 5..939 | 1..935 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7339-RA | 5..939 | 1..935 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7339-RA | 33..967 | 1..935 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7339-RA | 5..939 | 1..935 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7339-RA | 33..967 | 1..935 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11648788..11648951 | 1..164 | 100 | -> | Plus |
3L | 11649009..11649491 | 165..647 | 99 | -> | Plus |
3L | 11649551..11649838 | 648..935 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11648788..11648951 | 1..164 | 100 | -> | Plus |
3L | 11649009..11649491 | 165..647 | 99 | -> | Plus |
3L | 11649551..11649838 | 648..935 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11648788..11648951 | 1..164 | 100 | -> | Plus |
3L | 11649009..11649491 | 165..647 | 99 | -> | Plus |
3L | 11649551..11649838 | 648..935 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 11641888..11642051 | 1..164 | 100 | -> | Plus |
arm_3L | 11642109..11642591 | 165..647 | 99 | -> | Plus |
arm_3L | 11642651..11642938 | 648..935 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11642651..11642938 | 648..935 | 98 | Plus | |
3L | 11642109..11642591 | 165..647 | 99 | -> | Plus |
3L | 11641888..11642051 | 1..164 | 100 | -> | Plus |
Translation from 53 to 775
> GM16372.hyp MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKD IVSLKDSIILPGDGASHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVT LGFFDDILIPHAALQHPSRFDEAEQAWVWEYPLEDGAKHDLFMDVGEPIK FRVSREIFEETSPIGPPKTEAQTQQGASTSAAVASATSQEVKTPYRIIGA INESGLGVLSWWDQQGKDDEQDDEEDEEYDDEDGEGACEE*
Translation from 53 to 775
> GM16372.pep MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKD IVSLKDSIILPGDGASHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVT LGFFDDILIPHAALQHPSRFDEAEQAWVWEYPLEDGAKHDLFMDVGEPIK FRVSREIFEETSPIGPPKTEAQTQQGASTSAAVASATSQEVKTPYRIIGA INESGLGVLSWWDQQGKDDEQDDEEDEEYDDEDGEGACEE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25280-PA | 244 | GF25280-PA | 1..244 | 1..240 | 1082 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15519-PA | 240 | GG15519-PA | 1..240 | 1..240 | 1235 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14863-PA | 246 | GH14863-PA | 1..246 | 1..240 | 1082 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7339-PB | 240 | CG7339-PB | 1..240 | 1..240 | 1252 | 100 | Plus |
CG7339-PA | 240 | CG7339-PA | 1..240 | 1..240 | 1252 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13714-PA | 245 | GI13714-PA | 1..245 | 1..240 | 1046 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16275-PA | 240 | GL16275-PA | 1..240 | 1..240 | 1081 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20275-PA | 240 | GA20275-PA | 1..240 | 1..240 | 1087 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25288-PA | 240 | GM25288-PA | 1..240 | 1..240 | 1254 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14319-PA | 240 | GD14319-PA | 1..240 | 1..240 | 1254 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14059-PA | 246 | GJ14059-PA | 1..246 | 1..240 | 1027 | 85.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12491-PA | 245 | GK12491-PA | 1..245 | 1..240 | 1031 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21834-PA | 240 | GE21834-PA | 1..240 | 1..240 | 1241 | 97.5 | Plus |