BDGP Sequence Production Resources |
Search the DGRC for GM19213
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 192 |
Well: | 13 |
Vector: | pOT2 |
Associated Gene/Transcript | mRpL13-RA |
Protein status: | GM19213.pep: gold |
Sequenced Size: | 641 |
Gene | Date | Evidence |
---|---|---|
mRpL13 | 2008-12-18 | 5.12 accounting |
CG10602 | 2008-12-18 | 5.12 accounting |
641 bp assembled on 2008-12-08
GenBank Submission: BT053702.1
> GM19213.complete TTTAAATTGTTTAATTAAAAATCTCAAAAAATGTCCATTGCGAAGCGTGT GCAGCAATGGGCAACGTTCGCGCGCACTTGGCACATTTACGATTGCACTT GGCAGAATCCATTCGAGTCGGCAAAACTGGTTAAAACGCATTTATTGGGC CTCCAAAAGCCCATTTACCACCCAATGAATGACTGCGGGGATCATGTGGT GCTGATCAACACGCGGGAAATCGCCTTGCCCGGTGACGAGTGGGTGAAGA GGGTTTACTTCCACCACACCGGCTATCCTGGTGGCGCTTCGTGGACCCTG GCGTGGCAGCTGCACGAGAAGGATCCCACGATGGTGATGAAGAAGGCCGT GTACAACTCGATGCGCGGAAATCTGCAGCGCAGGCACACCATGCAAAGAC TGCACTTGTTCGCCGACGATCAGGTGCCCGAGGAAATCCTGCAAAACGTC ACGAATCAAATCCGCACGCCGCGCTCTATTCCCCAGCGTCTGGATCATAT CGACAAAGAAACGCTGGAGAACTTCCCCAACATTATGGATTATCCCAAGG ATTATATCTTGCGTTGATATGCTGATAGGAAATCATTGTAATTAAGATAA ATACAAAATATGGAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 18856782..18857216 | 613..179 | 2160 | 99.8 | Minus |
chr2L | 23010047 | chr2L | 18857706..18857831 | 178..53 | 615 | 99.2 | Minus |
chr2L | 23010047 | chr2L | 18857891..18857944 | 54..1 | 270 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18858023..18858462 | 618..179 | 2185 | 99.8 | Minus |
2L | 23513712 | 2L | 18858952..18859077 | 178..53 | 615 | 99.2 | Minus |
2L | 23513712 | 2L | 18859137..18859190 | 54..1 | 270 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 18858023..18858462 | 618..179 | 2185 | 99.7 | Minus |
2L | 23513712 | 2L | 18858952..18859077 | 178..53 | 615 | 99.2 | Minus |
2L | 23513712 | 2L | 18859137..18859190 | 54..1 | 270 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 18856782..18857216 | 179..613 | 99 | <- | Minus |
chr2L | 18857706..18857829 | 55..178 | 99 | <- | Minus |
chr2L | 18857891..18857922 | 23..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL13-RA | 1..537 | 31..567 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL13-RA | 1..537 | 31..567 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL13-RA | 1..537 | 31..567 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL13-RA | 1..537 | 31..567 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL13-RA | 1..613 | 1..613 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL13-RA | 1..613 | 1..613 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL13-RA | 59..671 | 1..613 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL13-RA | 59..671 | 1..613 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18858028..18858462 | 179..613 | 99 | <- | Minus |
2L | 18858952..18859075 | 55..178 | 99 | <- | Minus |
2L | 18859137..18859190 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18858028..18858462 | 179..613 | 99 | <- | Minus |
2L | 18858952..18859075 | 55..178 | 99 | <- | Minus |
2L | 18859137..18859190 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18858028..18858462 | 179..613 | 99 | <- | Minus |
2L | 18858952..18859075 | 55..178 | 99 | <- | Minus |
2L | 18859137..18859190 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 18858952..18859075 | 55..178 | 99 | <- | Minus |
arm_2L | 18859137..18859190 | 1..54 | 100 | Minus | |
arm_2L | 18858028..18858462 | 179..613 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18858028..18858462 | 179..613 | 99 | <- | Minus |
2L | 18858952..18859075 | 55..178 | 99 | <- | Minus |
2L | 18859137..18859190 | 1..54 | 100 | Minus |
Translation from 30 to 566
> GM19213.pep MSIAKRVQQWATFARTWHIYDCTWQNPFESAKLVKTHLLGLQKPIYHPMN DCGDHVVLINTREIALPGDEWVKRVYFHHTGYPGGASWTLAWQLHEKDPT MVMKKAVYNSMRGNLQRRHTMQRLHLFADDQVPEEILQNVTNQIRTPRSI PQRLDHIDKETLENFPNIMDYPKDYILR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20676-PA | 178 | GF20676-PA | 1..178 | 1..178 | 943 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21677-PA | 178 | GG21677-PA | 1..178 | 1..178 | 965 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11523-PA | 178 | GH11523-PA | 1..178 | 1..178 | 916 | 92.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL13-PA | 178 | CG10603-PA | 1..178 | 1..178 | 982 | 100 | Plus |
CG10602-PF | 684 | CG10602-PF | 1..49 | 1..49 | 276 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17018-PA | 178 | GI17018-PA | 1..178 | 1..178 | 932 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18826-PA | 178 | GL18826-PA | 1..178 | 1..178 | 917 | 92.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10432-PA | 178 | GA10432-PA | 1..178 | 1..178 | 917 | 92.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17054-PA | 178 | GM17054-PA | 1..178 | 1..178 | 963 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21802-PA | 178 | GD21802-PA | 1..178 | 1..178 | 963 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24452-PA | 178 | GJ24452-PA | 1..178 | 1..178 | 919 | 92.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23896-PA | 178 | GK23896-PA | 1..178 | 1..178 | 917 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12697-PA | 178 | GE12697-PA | 1..178 | 1..178 | 965 | 99.4 | Plus |
Translation from 30 to 566
> GM19213.hyp MSIAKRVQQWATFARTWHIYDCTWQNPFESAKLVKTHLLGLQKPIYHPMN DCGDHVVLINTREIALPGDEWVKRVYFHHTGYPGGASWTLAWQLHEKDPT MVMKKAVYNSMRGNLQRRHTMQRLHLFADDQVPEEILQNVTNQIRTPRSI PQRLDHIDKETLENFPNIMDYPKDYILR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL13-PA | 178 | CG10603-PA | 1..178 | 1..178 | 982 | 100 | Plus |