Clone GM19213 Report

Search the DGRC for GM19213

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:192
Well:13
Vector:pOT2
Associated Gene/TranscriptmRpL13-RA
Protein status:GM19213.pep: gold
Sequenced Size:641

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpL13 2008-12-18 5.12 accounting
CG10602 2008-12-18 5.12 accounting

Clone Sequence Records

GM19213.complete Sequence

641 bp assembled on 2008-12-08

GenBank Submission: BT053702.1

> GM19213.complete
TTTAAATTGTTTAATTAAAAATCTCAAAAAATGTCCATTGCGAAGCGTGT
GCAGCAATGGGCAACGTTCGCGCGCACTTGGCACATTTACGATTGCACTT
GGCAGAATCCATTCGAGTCGGCAAAACTGGTTAAAACGCATTTATTGGGC
CTCCAAAAGCCCATTTACCACCCAATGAATGACTGCGGGGATCATGTGGT
GCTGATCAACACGCGGGAAATCGCCTTGCCCGGTGACGAGTGGGTGAAGA
GGGTTTACTTCCACCACACCGGCTATCCTGGTGGCGCTTCGTGGACCCTG
GCGTGGCAGCTGCACGAGAAGGATCCCACGATGGTGATGAAGAAGGCCGT
GTACAACTCGATGCGCGGAAATCTGCAGCGCAGGCACACCATGCAAAGAC
TGCACTTGTTCGCCGACGATCAGGTGCCCGAGGAAATCCTGCAAAACGTC
ACGAATCAAATCCGCACGCCGCGCTCTATTCCCCAGCGTCTGGATCATAT
CGACAAAGAAACGCTGGAGAACTTCCCCAACATTATGGATTATCCCAAGG
ATTATATCTTGCGTTGATATGCTGATAGGAAATCATTGTAATTAAGATAA
ATACAAAATATGGAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GM19213.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL13-RA 618 mRpL13-RA 1..618 1..618 3060 99.6 Plus
CG10602-RA 2236 CG10602-RA 23..200 1..178 875 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18856782..18857216 613..179 2160 99.8 Minus
chr2L 23010047 chr2L 18857706..18857831 178..53 615 99.2 Minus
chr2L 23010047 chr2L 18857891..18857944 54..1 270 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18858023..18858462 618..179 2185 99.8 Minus
2L 23513712 2L 18858952..18859077 178..53 615 99.2 Minus
2L 23513712 2L 18859137..18859190 54..1 270 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18858023..18858462 618..179 2185 99.7 Minus
2L 23513712 2L 18858952..18859077 178..53 615 99.2 Minus
2L 23513712 2L 18859137..18859190 54..1 270 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:33:58 has no hits.

GM19213.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:34:51 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18856782..18857216 179..613 99 <- Minus
chr2L 18857706..18857829 55..178 99 <- Minus
chr2L 18857891..18857922 23..54 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:52 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL13-RA 1..537 31..567 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:14 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL13-RA 1..537 31..567 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:36:33 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL13-RA 1..537 31..567 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:33:16 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL13-RA 1..537 31..567 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-08 11:44:15 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL13-RA 1..613 1..613 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:14 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL13-RA 1..613 1..613 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:36:33 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL13-RA 59..671 1..613 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:16 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL13-RA 59..671 1..613 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:34:51 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18858028..18858462 179..613 99 <- Minus
2L 18858952..18859075 55..178 99 <- Minus
2L 18859137..18859190 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:34:51 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18858028..18858462 179..613 99 <- Minus
2L 18858952..18859075 55..178 99 <- Minus
2L 18859137..18859190 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:34:51 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18858028..18858462 179..613 99 <- Minus
2L 18858952..18859075 55..178 99 <- Minus
2L 18859137..18859190 1..54 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:36:33 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18858952..18859075 55..178 99 <- Minus
arm_2L 18859137..18859190 1..54 100   Minus
arm_2L 18858028..18858462 179..613 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:52:51 Download gff for GM19213.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18858028..18858462 179..613 99 <- Minus
2L 18858952..18859075 55..178 99 <- Minus
2L 18859137..18859190 1..54 100   Minus

GM19213.pep Sequence

Translation from 30 to 566

> GM19213.pep
MSIAKRVQQWATFARTWHIYDCTWQNPFESAKLVKTHLLGLQKPIYHPMN
DCGDHVVLINTREIALPGDEWVKRVYFHHTGYPGGASWTLAWQLHEKDPT
MVMKKAVYNSMRGNLQRRHTMQRLHLFADDQVPEEILQNVTNQIRTPRSI
PQRLDHIDKETLENFPNIMDYPKDYILR*

GM19213.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20676-PA 178 GF20676-PA 1..178 1..178 943 96.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21677-PA 178 GG21677-PA 1..178 1..178 965 99.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11523-PA 178 GH11523-PA 1..178 1..178 916 92.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL13-PA 178 CG10603-PA 1..178 1..178 982 100 Plus
CG10602-PF 684 CG10602-PF 1..49 1..49 276 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17018-PA 178 GI17018-PA 1..178 1..178 932 94.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18826-PA 178 GL18826-PA 1..178 1..178 917 92.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10432-PA 178 GA10432-PA 1..178 1..178 917 92.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17054-PA 178 GM17054-PA 1..178 1..178 963 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21802-PA 178 GD21802-PA 1..178 1..178 963 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24452-PA 178 GJ24452-PA 1..178 1..178 919 92.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23896-PA 178 GK23896-PA 1..178 1..178 917 91.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12697-PA 178 GE12697-PA 1..178 1..178 965 99.4 Plus

GM19213.hyp Sequence

Translation from 30 to 566

> GM19213.hyp
MSIAKRVQQWATFARTWHIYDCTWQNPFESAKLVKTHLLGLQKPIYHPMN
DCGDHVVLINTREIALPGDEWVKRVYFHHTGYPGGASWTLAWQLHEKDPT
MVMKKAVYNSMRGNLQRRHTMQRLHLFADDQVPEEILQNVTNQIRTPRSI
PQRLDHIDKETLENFPNIMDYPKDYILR*

GM19213.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL13-PA 178 CG10603-PA 1..178 1..178 982 100 Plus