Clone GM19936 Report

Search the DGRC for GM19936

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:199
Well:36
Vector:pOT2
Associated Gene/TranscriptSmE-RA
Protein status:GM19936.pep: gold
Preliminary Size:285
Sequenced Size:519

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18591 2002-01-01 Sim4 clustering to Release 2
CG18591 2002-11-19 Blastp of sequenced clone
CG18591 2003-01-01 Sim4 clustering to Release 3
CG18591 2008-04-29 Release 5.5 accounting
CG18591 2008-08-15 Release 5.9 accounting
CG18591 2008-12-18 5.12 accounting

Clone Sequence Records

GM19936.complete Sequence

519 bp (519 high quality bases) assembled on 2002-11-19

GenBank Submission: BT003597

> GM19936.complete
ATCGCCTGGACGAAAAGAAGACGCCGGCAAAAAGAAGCGAAAATTTGTTT
AACTCAAATTAAGTCGTCGGAAATCAGCAAAAATGTCGTTCAAAGGAAAT
CCCAAGGTGCAGAAGGTGATGGTGCAGCCCATCAACCTGATCTTCCGTTA
CCTGCAGAACCGGTCCCGCGTGCAAGTTTGGTTATACGAGAACATATCGC
TGCGCATCGAGGGCCACATTGTGGGATTCGATGAGTACATGAATCTGGTG
CTGGACGACGCCGAGGAAGTCTATGTGAAGACCCGGCAGCGCCGCAACCT
CGGGAGGATCATGCTCAAGGGCGACAACATCACGCTCATACAGAACGTCA
GTCCCACGAAGGACTAGGCGACTCAGCGGCCATCCTGCGAATCCTTCGAA
TTCCACCTGCAAACGCTGAACGCCCTTAATATAAGTAAAATAAATGTAAA
GCCGATATCTGAAGACGAATGTTGAAATAAATGGTAGACTTTCTGTAAAA
AAAAAAAAAAAAAAAAAAA

GM19936.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG18591-RA 494 CG18591-RA 1..494 1..494 2470 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7883967..7884462 496..1 2480 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7884928..7885425 498..1 2490 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7884928..7885425 498..1 2490 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:31:36 has no hits.

GM19936.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:32:21 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7883967..7884462 1..496 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:54 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
CG18591-RA 1..285 83..367 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:03:35 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
SmE-RA 1..285 83..367 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:32:03 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
SmE-RA 1..285 83..367 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:53:51 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
CG18591-RA 1..285 83..367 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:09:19 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
SmE-RA 1..285 83..367 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:22:13 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
CG18591-RA 1..494 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:03:35 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
SmE-RA 1..494 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:32:03 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
SmE-RA 26..521 1..496 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:53:51 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
CG18591-RA 1..494 1..494 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:09:19 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
SmE-RA 26..521 1..496 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:32:21 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7884930..7885425 1..496 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:32:21 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7884930..7885425 1..496 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:32:21 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7884930..7885425 1..496 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:32:03 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7884930..7885425 1..496 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:26:03 Download gff for GM19936.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7884930..7885425 1..496 100   Minus

GM19936.hyp Sequence

Translation from 82 to 366

> GM19936.hyp
MSFKGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFD
EYMNLVLDDAEEVYVKTRQRRNLGRIMLKGDNITLIQNVSPTKD*

GM19936.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
SmE-PA 94 CG18591-PA 1..94 1..94 482 100 Plus

GM19936.pep Sequence

Translation from 82 to 366

> GM19936.pep
MSFKGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFD
EYMNLVLDDAEEVYVKTRQRRNLGRIMLKGDNITLIQNVSPTKD*

GM19936.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
SmE-PA 94 CG18591-PA 1..94 1..94 482 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15004-PB 94 GA15004-PB 1..94 1..94 474 95.7 Plus