Clone GM20805 Report

Search the DGRC for GM20805

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:208
Well:5
Vector:pOT2
Associated Gene/TranscriptArl1-RA
Protein status:GM20805.pep: gold
Preliminary Size:568
Sequenced Size:945

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6025 2002-01-01 Sim4 clustering to Release 2
CG6025 2002-07-14 Blastp of sequenced clone
CG6025 2003-01-01 Sim4 clustering to Release 3
Arf72A 2008-04-29 Release 5.5 accounting
Arf72A 2008-08-15 Release 5.9 accounting
Arf72A 2008-12-18 5.12 accounting

Clone Sequence Records

GM20805.complete Sequence

945 bp (945 high quality bases) assembled on 2002-07-14

GenBank Submission: BT001460

> GM20805.complete
AATGGCAAAAACGAAACCATTCTCCAGCCCAAAAAAAAGTGAAAACAAGA
CTTCTGCGATTTTGTATTAATTGTAGCACCACATACAATTAACTAGGTTT
ACTAAACTTAAGCATTTAGAGGCAGCGCCAGCACTAGACAAAGTTCAGCC
GTAATCATGGGTGGGGTGCTCAGCTACTTTCGCGGACTGCTCGGCTCCCG
GGAGATGCGCATCTTGATCCTGGGCCTGGACGGCGCCGGCAAGACCACGA
TCCTCTACAGACTGCAGGTGGGCGAGGTGGTCACCACGATACCCACCATC
GGCTTCAACGTGGAGCAGGTCACCTACAAGAACCTCAAGTTCCAGGTCTG
GGATTTGGGCGGACAGACAAGTATTAGACCTTATTGGCGTTGCTACTACA
GCAACACGGACGCAATCATCTATGTGGTGGACTCGGCGGACCGGGACCGC
ATTGGCATCTCCAAGGACGAGCTGCTGTACATGCTGCGTGAGGAGGAGCT
GGCCGGCGCGATACTGGTCGTCCTGGCGAACAAGCAGGACATGGACGGAT
GCATGACCGTCGCCGAGGTCCATCATGCGTTAGGACTGGAGAACCTAAAG
AACCGCACATTTCAAATATTCAAAACGTCGGCCACCAAGGGCGAGGGACT
CGACCAGGCCATGGACTGGCTGTCCAACACCCTGCAGAGTCGCAAGTAGA
TACTTAGCCAGTCCTCAGACCCCCAGATCCCTGTGTAAAAAATGTGTGTC
CAAAGCATCGCCAGCTAGGGAACGTCAACAGCTTTTTTCAAATTGCAGAT
TGCGCAAAAAATCCACGAACCGAAAGAAACTTTGTAATAACTTCTAGTAA
TATAATTATTAAATTATAGGATTAAACAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GM20805.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
Arf72A-RA 1021 Arf72A-RA 112..990 1..879 4395 100 Plus
DNApol-delta-RA 3486 DNApol-delta-RA 3438..3486 879..831 245 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15973664..15974168 375..879 2525 100 Plus
chr3L 24539361 chr3L 15973181..15973398 160..377 1090 100 Plus
chr3L 24539361 chr3L 15972925..15973086 1..162 810 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15983860..15984364 375..879 2525 100 Plus
3L 28110227 3L 15983377..15983594 160..377 1090 100 Plus
3L 28110227 3L 15983121..15983282 1..162 810 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15976960..15977464 375..879 2525 100 Plus
3L 28103327 3L 15976477..15976694 160..377 1090 100 Plus
3L 28103327 3L 15976221..15976382 1..162 810 100 Plus
Blast to na_te.dros performed 2019-03-16 17:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1047..1098 908..856 136 75.5 Minus

GM20805.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:46:05 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15972925..15973084 1..160 100 -> Plus
chr3L 15973182..15973398 161..377 100 -> Plus
chr3L 15973667..15974132 378..843 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:09:59 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
Arf72A-RA 1..543 157..699 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:50:41 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
Arf72A-RA 1..543 157..699 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:00:37 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
Arl1-RA 1..543 157..699 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:32:54 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
Arf72A-RA 1..543 157..699 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:05:35 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
Arl1-RA 1..543 157..699 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:01:39 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
Arf72A-RA 1..877 1..877 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:50:41 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
Arf72A-RA 1..877 1..877 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:00:37 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
Arl1-RA 1..863 15..877 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:32:54 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
Arf72A-RA 1..877 1..877 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:05:35 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
Arl1-RA 1..863 15..877 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:46:05 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15983378..15983594 161..377 100 -> Plus
3L 15983121..15983280 1..160 100 -> Plus
3L 15983863..15984362 378..877 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:46:05 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15983378..15983594 161..377 100 -> Plus
3L 15983121..15983280 1..160 100 -> Plus
3L 15983863..15984362 378..877 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:46:05 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15983378..15983594 161..377 100 -> Plus
3L 15983121..15983280 1..160 100 -> Plus
3L 15983863..15984362 378..877 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:00:37 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15976221..15976380 1..160 100 -> Plus
arm_3L 15976478..15976694 161..377 100 -> Plus
arm_3L 15976963..15977462 378..877 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:13:19 Download gff for GM20805.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15976478..15976694 161..377 100 -> Plus
3L 15976963..15977462 378..877 100   Plus
3L 15976221..15976380 1..160 100 -> Plus

GM20805.hyp Sequence

Translation from 156 to 698

> GM20805.hyp
MGGVLSYFRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGF
NVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIG
ISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNR
TFQIFKTSATKGEGLDQAMDWLSNTLQSRK*

GM20805.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Arl1-PA 180 CG6025-PA 1..180 1..180 926 100 Plus
Arf79F-PJ 182 CG8385-PJ 1..179 1..178 548 57.5 Plus
Arf79F-PI 182 CG8385-PI 1..179 1..178 548 57.5 Plus
Arf79F-PH 182 CG8385-PH 1..179 1..178 548 57.5 Plus
Arf79F-PF 182 CG8385-PF 1..179 1..178 548 57.5 Plus

GM20805.pep Sequence

Translation from 156 to 698

> GM20805.pep
MGGVLSYFRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGF
NVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIG
ISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNR
TFQIFKTSATKGEGLDQAMDWLSNTLQSRK*

GM20805.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24106-PA 180 GF24106-PA 1..180 1..180 950 100 Plus
Dana\GF23441-PA 182 GF23441-PA 1..179 1..178 560 57.5 Plus
Dana\GF23416-PA 180 GF23416-PA 7..180 6..179 509 55.7 Plus
Dana\GF13030-PA 175 GF13030-PA 1..171 1..174 482 51.1 Plus
Dana\GF23565-PA 179 GF23565-PA 1..179 1..179 445 45.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15940-PA 190 GG15940-PA 12..190 2..180 946 100 Plus
Dere\GG13164-PA 182 GG13164-PA 1..179 1..178 560 57.5 Plus
Dere\GG16407-PA 180 GG16407-PA 5..180 4..179 507 55.1 Plus
Dere\GG20511-PA 175 GG20511-PA 1..171 1..174 482 51.1 Plus
Dere\GG15097-PA 179 GG15097-PA 1..179 1..179 441 45.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14778-PA 180 GH14778-PA 1..180 1..180 950 100 Plus
Dgri\GH14762-PA 182 GH14762-PA 1..179 1..178 560 57.5 Plus
Dgri\GH23951-PA 180 GH23951-PA 5..180 4..179 509 55.1 Plus
Dgri\GH14763-PA 182 GH14763-PA 1..179 1..178 504 52 Plus
Dgri\GH20425-PA 175 GH20425-PA 1..171 1..174 483 51.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Arl1-PA 180 CG6025-PA 1..180 1..180 926 100 Plus
Arf79F-PJ 182 CG8385-PJ 1..179 1..178 548 57.5 Plus
Arf79F-PI 182 CG8385-PI 1..179 1..178 548 57.5 Plus
Arf79F-PH 182 CG8385-PH 1..179 1..178 548 57.5 Plus
Arf79F-PF 182 CG8385-PF 1..179 1..178 548 57.5 Plus
Arf79F-PC 182 CG8385-PC 1..179 1..178 548 57.5 Plus
Arf79F-PE 182 CG8385-PE 1..179 1..178 548 57.5 Plus
Arf79F-PB 182 CG8385-PB 1..179 1..178 548 57.5 Plus
Arf79F-PA 182 CG8385-PA 1..179 1..178 548 57.5 Plus
Arf102F-PB 180 CG11027-PB 5..180 4..179 497 55.7 Plus
Arf102F-PA 180 CG11027-PA 5..180 4..179 497 55.7 Plus
Arf51F-PE 175 CG8156-PE 1..171 1..174 473 51.1 Plus
Arf51F-PA 175 CG8156-PA 1..171 1..174 473 51.1 Plus
Arf51F-PC 175 CG8156-PC 1..171 1..174 473 51.1 Plus
Arf51F-PB 175 CG8156-PB 1..171 1..174 473 51.1 Plus
Arf51F-PD 175 CG8156-PD 1..171 1..174 473 51.1 Plus
Arl5-PA 179 CG7197-PA 1..179 1..179 431 45.3 Plus
dnd-PA 179 CG6560-PA 2..178 3..177 391 44.1 Plus
Arl2-PA 184 CG7435-PA 15..179 15..179 381 46.1 Plus
Arl8-PC 186 CG7891-PC 8..177 4..172 292 32.4 Plus
Arl8-PB 186 CG7891-PB 8..177 4..172 292 32.4 Plus
Arl8-PA 186 CG7891-PA 8..177 4..172 292 32.4 Plus
Arl4-PA 312 CG2219-PA 25..162 17..149 291 42.8 Plus
Arl4-PB 313 CG2219-PB 26..163 17..149 291 42.8 Plus
Sar1-PE 193 CG7073-PE 3..189 4..173 268 31.6 Plus
Sar1-PC 193 CG7073-PC 3..189 4..173 268 31.6 Plus
Sar1-PD 193 CG7073-PD 3..189 4..173 268 31.6 Plus
Sar1-PA 193 CG7073-PA 3..189 4..173 268 31.6 Plus
Arl6-PB 201 CG7735-PB 17..178 16..172 266 37 Plus
Arl6-PA 202 CG7735-PA 17..179 16..172 266 36.8 Plus
Arfrp1-PA 200 CG7039-PA 20..188 19..177 249 34.5 Plus
CG17819-PA 186 CG17819-PA 5..185 3..180 230 28.7 Plus
Arl4-PC 100 CG2219-PC 25..93 17..80 186 50.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11881-PA 180 GI11881-PA 1..180 1..180 944 98.9 Plus
Dmoj\GI11864-PA 182 GI11864-PA 1..179 1..178 560 57.5 Plus
Dmoj\GI14031-PA 180 GI14031-PA 7..180 6..179 508 55.7 Plus
Dmoj\GI19608-PA 175 GI19608-PA 1..171 1..174 480 51.1 Plus
Dmoj\GI16622-PA 179 GI16622-PA 1..179 1..179 444 45.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12747-PA 180 GL12747-PA 1..180 1..180 947 99.4 Plus
Dper\GL25178-PA 182 GL25178-PA 1..179 1..178 560 57.5 Plus
Dper\GL18404-PA 180 GL18404-PA 7..180 6..179 512 56.3 Plus
Dper\GL17751-PA 175 GL17751-PA 1..171 1..174 484 51.1 Plus
Dper\GL24385-PA 181 GL24385-PA 1..178 1..178 476 51.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19306-PA 180 GA19306-PA 1..180 1..180 947 99.4 Plus
Dpse\GA21036-PA 182 GA21036-PA 1..179 1..178 560 57.5 Plus
Dpse\GA10714-PA 180 GA10714-PA 7..180 6..179 512 56.3 Plus
Dpse\GA20856-PA 175 GA20856-PA 1..171 1..174 484 51.1 Plus
Dpse\GA23613-PA 181 GA23613-PA 1..178 1..178 476 51.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25571-PA 180 GM25571-PA 1..180 1..180 950 100 Plus
Dsec\GM22073-PA 182 GM22073-PA 1..179 1..178 560 57.5 Plus
Dsec\GM13026-PA 180 GM13026-PA 7..180 6..179 509 56.3 Plus
Dsec\GM21603-PA 175 GM21603-PA 1..171 1..174 482 51.1 Plus
Dsec\GM24953-PA 179 GM24953-PA 1..179 1..179 441 45.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14586-PA 180 GD14586-PA 1..180 1..180 950 100 Plus
Dsim\GD12049-PA 182 GD12049-PA 1..179 1..178 560 57.5 Plus
Dsim\GD20493-PA 180 GD20493-PA 7..180 6..179 509 56.3 Plus
Dsim\GD11108-PA 175 GD11108-PA 1..171 1..174 482 51.1 Plus
Dsim\GD13004-PA 179 GD13004-PA 1..179 1..179 441 45.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13575-PA 180 GJ13575-PA 1..180 1..180 944 98.9 Plus
Dvir\GJ13559-PA 182 GJ13559-PA 1..179 1..178 560 57.5 Plus
Dvir\GJ19602-PA 180 GJ19602-PA 7..180 6..179 508 55.7 Plus
Dvir\GJ14973-PA 175 GJ14973-PA 1..171 1..174 480 51.1 Plus
Dvir\GJ12878-PA 179 GJ12878-PA 1..179 1..179 445 45.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24495-PA 167 GK24495-PA 1..167 14..180 881 99.4 Plus
Dwil\GK20496-PA 182 GK20496-PA 1..179 1..178 560 57.5 Plus
Dwil\GK13623-PA 180 GK13623-PA 7..180 6..179 509 55.7 Plus
Dwil\GK20891-PA 175 GK20891-PA 1..171 1..174 480 51.1 Plus
Dwil\GK17000-PA 179 GK17000-PA 1..179 1..179 445 45.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22880-PA 180 GE22880-PA 1..180 1..180 950 100 Plus
Dyak\GE19486-PA 182 GE19486-PA 1..179 1..178 560 57.5 Plus
Dyak\Arf102F-PA 180 GE14567-PA 5..180 4..179 507 55.1 Plus
Dyak\GE13644-PA 175 GE13644-PA 1..171 1..174 482 51.1 Plus
Dyak\GE21319-PA 179 GE21319-PA 1..179 1..179 441 45.3 Plus