Clone GM20929 Report

Search the DGRC for GM20929

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:209
Well:29
Vector:pOT2
Associated Gene/TranscriptCG33774-RA
Protein status:GM20929.pep: Imported from assembly
Sequenced Size:294

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33774 2008-04-29 Release 5.5 accounting
CG33774 2008-08-15 Release 5.9 accounting
CG33774 2008-12-18 5.12 accounting

Clone Sequence Records

GM20929.complete Sequence

294 bp (294 high quality bases) assembled on 2020-02-20

GenBank Submission: BT001461

> GM20929.complete
AAACCGGCTCGTTTTTTCGCTGAAAAAGAACGTGTTACTGTCTGCAAAAT
GATCACCGACGTGCAATTGGCCATTTTCTCCAACGTTCTGGGCGTATTTC
TGTTCCTGCTGGTGGTTGCCTATCATTATATTAATGCCAATACCGGAAAG
CCCAGCGCCAAGGCAAAATGATGTAGGATGTTTCCGCTAACAGACTAATA
TAGTTGTACCAGGATAATGATAATGCTGCTTCATTCGCAAAATAAATATG
TAGTTGTACAAATCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GM20929.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG33774-RA 332 CG33774-RA 66..332 1..267 1305 99.2 Plus
l(2)k10201-RA 811 l(2)k10201-RA 663..780 267..150 560 98.3 Minus
Blast to d_melanogaster_OreR.fa performed 2020-02-20 10:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5287437..5287560 150..27 620 100 Minus
chr2R 21145070 chr2R 5287243..5287358 265..150 565 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:20 has no hits.
Blast to dmel-all-transcript-r6.23.fasta performed 2020-02-20 10:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG33774-RA 310 CG33774-RA 46..310 1..265 1295 99.2 Plus
l(2)k10201-RA 820 CG13951-RA 674..789 265..150 550 98.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2020-02-20 10:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9399947..9400070 150..27 620 100 Minus
2R 25286936 2R 9399751..9399868 267..150 560 98.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9401146..9401269 150..27 620 100 Minus
2R 25260384 2R 9400950..9401067 267..150 560 98.3 Minus
2R 25260384 2R 9401456..9401483 28..1 140 100 Minus
Blast to na_te.dros performed on 2020-02-20 10:18:45 has no hits.

GM20929.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2020-02-20 10:18:55 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5287243..5287358 150..265 99 <- Minus
chr2R 5287438..5287558 29..149 100 <- Minus
chr2R 5287747..5287774 1..28 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:00 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 1..123 49..171 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:50:18 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 1..123 49..171 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:13:40 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 1..123 49..171 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:32:25 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 1..123 49..171 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:11:41 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 1..123 49..171 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:01:07 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 21..285 1..265 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:50:18 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 21..285 1..265 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:13:40 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 46..310 1..265 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:32:26 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 1..265 1..265 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:11:41 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 46..310 1..265 99   Plus
Sim4 to dmel-all-transcript-r6.23.fasta performed 2020-02-20 10:18:55 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 46..310 1..265 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2020-02-20 10:18:55 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9399753..9399868 150..265 98 <- Minus
2R 9399948..9400068 29..149 100 <- Minus
2R 9400257..9400284 1..28 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2020-02-20 10:18:55 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9399753..9399868 150..265 98 <- Minus
2R 9399948..9400068 29..149 100 <- Minus
2R 9400257..9400284 1..28 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:13:40 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5287762..5287789 1..28 100   Minus
arm_2R 5287258..5287373 150..265 98 <- Minus
arm_2R 5287453..5287573 29..149 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:12:33 Download gff for GM20929.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9400952..9401067 150..265 98 <- Minus
2R 9401147..9401267 29..149 100 <- Minus
2R 9401456..9401483 1..28 100   Minus

GM20929.hyp Sequence

Translation from 0 to 170

> GM20929.hyp
KPARFFAEKERVTVCKMITDVQLAIFSNVLGVFLFLLVVAYHYINANTGK
PSAKAK*

GM20929.hyp Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2020-02-20 10:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG33774-PA 40 CG33774-PA 1..40 17..56 198 100 Plus

GM20929.pep Sequence

Translation from 0 to 170

> GM20929.pep
KPARFFAEKERVTVCKMITDVQLAIFSNVLGVFLFLLVVAYHYINANTGK
PSAKAK*

GM20929.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2020-02-20 10:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13081-PA 40 GF13081-PA 1..40 17..56 189 95 Plus
Blast to dere-all-translation-r1.3.fasta performed 2020-02-20 10:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10558-PA 40 GG10558-PA 1..40 17..56 202 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2020-02-20 10:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21310-PA 40 GH21310-PA 1..40 17..56 180 90 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2020-02-20 10:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG33774-PA 40 CG33774-PA 1..40 17..56 198 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2020-02-20 10:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16965-PA 34 GI16965-PA 1..34 17..50 171 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2020-02-20 10:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16887-PA 40 GL16887-PA 1..40 17..56 188 95 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2020-02-20 10:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24324-PA 40 GA24324-PA 1..40 17..56 188 95 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2020-02-20 10:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20604-PA 40 GM20604-PA 1..40 17..56 199 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2020-02-20 10:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10077-PA 40 GD10077-PA 1..40 17..56 199 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2020-02-20 10:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18037-PA 40 GJ18037-PA 1..40 17..56 186 92.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2020-02-20 10:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20863-PA 34 GK20863-PA 1..34 17..50 171 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2020-02-20 10:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22313-PA 40 GE22313-PA 1..40 17..56 198 97.5 Plus