BDGP Sequence Production Resources |
Search the DGRC for GM20929
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 209 |
Well: | 29 |
Vector: | pOT2 |
Associated Gene/Transcript | CG33774-RA |
Protein status: | GM20929.pep: Imported from assembly |
Sequenced Size: | 294 |
Gene | Date | Evidence |
---|---|---|
CG33774 | 2008-04-29 | Release 5.5 accounting |
CG33774 | 2008-08-15 | Release 5.9 accounting |
CG33774 | 2008-12-18 | 5.12 accounting |
294 bp (294 high quality bases) assembled on 2020-02-20
GenBank Submission: BT001461
> GM20929.complete AAACCGGCTCGTTTTTTCGCTGAAAAAGAACGTGTTACTGTCTGCAAAAT GATCACCGACGTGCAATTGGCCATTTTCTCCAACGTTCTGGGCGTATTTC TGTTCCTGCTGGTGGTTGCCTATCATTATATTAATGCCAATACCGGAAAG CCCAGCGCCAAGGCAAAATGATGTAGGATGTTTCCGCTAACAGACTAATA TAGTTGTACCAGGATAATGATAATGCTGCTTCATTCGCAAAATAAATATG TAGTTGTACAAATCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 5287243..5287358 | 150..265 | 99 | <- | Minus |
chr2R | 5287438..5287558 | 29..149 | 100 | <- | Minus |
chr2R | 5287747..5287774 | 1..28 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 1..123 | 49..171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 1..123 | 49..171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 1..123 | 49..171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 1..123 | 49..171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 1..123 | 49..171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 21..285 | 1..265 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 21..285 | 1..265 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 46..310 | 1..265 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 1..265 | 1..265 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 46..310 | 1..265 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33774-RA | 46..310 | 1..265 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9399753..9399868 | 150..265 | 98 | <- | Minus |
2R | 9399948..9400068 | 29..149 | 100 | <- | Minus |
2R | 9400257..9400284 | 1..28 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9399753..9399868 | 150..265 | 98 | <- | Minus |
2R | 9399948..9400068 | 29..149 | 100 | <- | Minus |
2R | 9400257..9400284 | 1..28 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 5287762..5287789 | 1..28 | 100 | Minus | |
arm_2R | 5287258..5287373 | 150..265 | 98 | <- | Minus |
arm_2R | 5287453..5287573 | 29..149 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9400952..9401067 | 150..265 | 98 | <- | Minus |
2R | 9401147..9401267 | 29..149 | 100 | <- | Minus |
2R | 9401456..9401483 | 1..28 | 100 | Minus |
Translation from 0 to 170
> GM20929.hyp KPARFFAEKERVTVCKMITDVQLAIFSNVLGVFLFLLVVAYHYINANTGK PSAKAK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33774-PA | 40 | CG33774-PA | 1..40 | 17..56 | 198 | 100 | Plus |
Translation from 0 to 170
> GM20929.pep KPARFFAEKERVTVCKMITDVQLAIFSNVLGVFLFLLVVAYHYINANTGK PSAKAK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13081-PA | 40 | GF13081-PA | 1..40 | 17..56 | 189 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10558-PA | 40 | GG10558-PA | 1..40 | 17..56 | 202 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21310-PA | 40 | GH21310-PA | 1..40 | 17..56 | 180 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33774-PA | 40 | CG33774-PA | 1..40 | 17..56 | 198 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16965-PA | 34 | GI16965-PA | 1..34 | 17..50 | 171 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16887-PA | 40 | GL16887-PA | 1..40 | 17..56 | 188 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24324-PA | 40 | GA24324-PA | 1..40 | 17..56 | 188 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20604-PA | 40 | GM20604-PA | 1..40 | 17..56 | 199 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10077-PA | 40 | GD10077-PA | 1..40 | 17..56 | 199 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18037-PA | 40 | GJ18037-PA | 1..40 | 17..56 | 186 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20863-PA | 34 | GK20863-PA | 1..34 | 17..50 | 171 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22313-PA | 40 | GE22313-PA | 1..40 | 17..56 | 198 | 97.5 | Plus |