Clone GM21080 Report

Search the DGRC for GM21080

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:210
Well:80
Vector:pOT2
Associated Gene/TranscriptCG11279-RA
Protein status:GM21080.pep: gold
Preliminary Size:437
Sequenced Size:460

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11279 2002-01-01 Sim4 clustering to Release 2
CG11279 2002-05-18 Blastp of sequenced clone
CG11279 2008-04-29 Release 5.5 accounting
CG11279 2008-08-15 Release 5.9 accounting
CG11279 2008-12-18 5.12 accounting

Clone Sequence Records

GM21080.complete Sequence

460 bp (460 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118854

> GM21080.complete
CTGCACAGCAAAACATTTATATTTTGTTTTCTTGATAAAAATTTGTCATT
TGTAAAGATGCCACAGGGAAAATTCAAGAAGGCCAAGCTACCAGCAGCGA
TACAGAAAAAGAAGAACCAAAAGCAAGCTGCTTTCACCCGTCGATCAAAT
GCGCCCATTCAGGCGAAAAAGGCCAAGTTCAATGAGACGCAGAAGATCAA
GTCCGTCATTTCGAAGTCGGTCAACAAGAGCGTGGAGAGCGAACTGCGCT
CCCGCGCCCACGAGGGCTACATCCAGTTGAGCAAGGCCCAGGAGGCGGTG
GCCAAGCACCACGCCTCCCAGGCGAAGGCGGCTGCGGCGGCCAGTACCGC
CAAGTCCGCGGAATAGCTTACTCTAGGCATAAGTACTCTGTTGATAACCA
AATGACCTGCATATTGTATAGTAAAACATTTCTAAAACTAAAAAAAAAAA
AAAAAAAAAA

GM21080.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG11279-RA 845 CG11279-RA 72..511 1..440 2155 99.3 Plus
CG11279.b 1201 CG11279.b 72..511 1..440 2155 99.3 Plus
CG11279.a 1965 CG11279.a 72..511 1..440 2155 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13037538..13037828 149..439 1455 100 Plus
chr3L 24539361 chr3L 13037327..13037474 1..148 740 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13047235..13047526 149..440 1430 99.3 Plus
3L 28110227 3L 13047024..13047171 1..148 725 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13040335..13040626 149..440 1430 99.3 Plus
3L 28103327 3L 13040124..13040271 1..148 725 99.3 Plus
Blast to na_te.dros performed on 2019-03-16 07:03:06 has no hits.

GM21080.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:04:05 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13037327..13037474 1..148 100 -> Plus
chr3L 13037538..13037828 149..439 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:04 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 1..309 58..366 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:19 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 1..309 58..366 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:06:12 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 1..309 58..366 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:37:33 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 1..309 58..366 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:02 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 1..309 58..366 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:20:37 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 1..437 1..437 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:19 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 1..437 1..437 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:12 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 14..452 1..439 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:37:33 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 1..437 1..437 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:02 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 14..452 1..439 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:05 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13047024..13047171 1..148 99 -> Plus
3L 13047235..13047525 149..439 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:05 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13047024..13047171 1..148 99 -> Plus
3L 13047235..13047525 149..439 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:05 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13047024..13047171 1..148 99 -> Plus
3L 13047235..13047525 149..439 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:12 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13040124..13040271 1..148 99 -> Plus
arm_3L 13040335..13040625 149..439 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:09:55 Download gff for GM21080.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13040335..13040625 149..439 99   Plus
3L 13040124..13040271 1..148 99 -> Plus

GM21080.hyp Sequence

Translation from 0 to 365

> GM21080.hyp
LHSKTFIFRFLDKNLSFVKMPQGKFKKAKLPAAIQKKKNQKQAAFTRRSN
APIQAKKAKFNETQKIKSVISKSVNKSVESELRSRAHEGYIQLSKAQEAV
AKHHASQAKAAAAASTAKSAE*

GM21080.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG11279-PC 102 CG11279-PC 1..102 20..121 492 100 Plus
CG11279-PB 102 CG11279-PB 1..102 20..121 492 100 Plus
CG11279-PA 102 CG11279-PA 1..102 20..121 492 100 Plus

GM21080.pep Sequence

Translation from 57 to 365

> GM21080.pep
MPQGKFKKAKLPAAIQKKKNQKQAAFTRRSNAPIQAKKAKFNETQKIKSV
ISKSVNKSVESELRSRAHEGYIQLSKAQEAVAKHHASQAKAAAAASTAKS
AE*

GM21080.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24029-PA 101 GF24029-PA 1..81 1..81 342 88.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15625-PA 102 GG15625-PA 1..102 1..102 490 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17145-PA 103 GH17145-PA 1..82 1..81 342 91.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11279-PC 102 CG11279-PC 1..102 1..102 492 100 Plus
CG11279-PB 102 CG11279-PB 1..102 1..102 492 100 Plus
CG11279-PA 102 CG11279-PA 1..102 1..102 492 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11754-PA 100 GI11754-PA 1..98 1..97 369 88.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25333-PA 107 GL25333-PA 1..84 1..85 388 92.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10885-PA 105 GA10885-PA 1..84 1..85 388 92.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25396-PA 102 GM25396-PA 1..102 1..102 493 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14428-PA 102 GD14428-PA 1..102 1..102 490 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13464-PA 107 GJ13464-PA 1..89 1..88 366 87.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17428-PA 103 GK17428-PA 1..82 1..81 361 90.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21950-PA 102 GE21950-PA 1..102 1..102 490 99 Plus