BDGP Sequence Production Resources |
Search the DGRC for GM21080
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 210 |
Well: | 80 |
Vector: | pOT2 |
Associated Gene/Transcript | CG11279-RA |
Protein status: | GM21080.pep: gold |
Preliminary Size: | 437 |
Sequenced Size: | 460 |
Gene | Date | Evidence |
---|---|---|
CG11279 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11279 | 2002-05-18 | Blastp of sequenced clone |
CG11279 | 2008-04-29 | Release 5.5 accounting |
CG11279 | 2008-08-15 | Release 5.9 accounting |
CG11279 | 2008-12-18 | 5.12 accounting |
460 bp (460 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118854
> GM21080.complete CTGCACAGCAAAACATTTATATTTTGTTTTCTTGATAAAAATTTGTCATT TGTAAAGATGCCACAGGGAAAATTCAAGAAGGCCAAGCTACCAGCAGCGA TACAGAAAAAGAAGAACCAAAAGCAAGCTGCTTTCACCCGTCGATCAAAT GCGCCCATTCAGGCGAAAAAGGCCAAGTTCAATGAGACGCAGAAGATCAA GTCCGTCATTTCGAAGTCGGTCAACAAGAGCGTGGAGAGCGAACTGCGCT CCCGCGCCCACGAGGGCTACATCCAGTTGAGCAAGGCCCAGGAGGCGGTG GCCAAGCACCACGCCTCCCAGGCGAAGGCGGCTGCGGCGGCCAGTACCGC CAAGTCCGCGGAATAGCTTACTCTAGGCATAAGTACTCTGTTGATAACCA AATGACCTGCATATTGTATAGTAAAACATTTCTAAAACTAAAAAAAAAAA AAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 13037327..13037474 | 1..148 | 100 | -> | Plus |
chr3L | 13037538..13037828 | 149..439 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11279-RA | 1..309 | 58..366 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11279-RA | 1..309 | 58..366 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11279-RA | 1..309 | 58..366 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11279-RA | 1..309 | 58..366 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11279-RA | 1..309 | 58..366 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11279-RA | 1..437 | 1..437 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11279-RA | 1..437 | 1..437 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11279-RA | 14..452 | 1..439 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11279-RA | 1..437 | 1..437 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11279-RA | 14..452 | 1..439 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13047024..13047171 | 1..148 | 99 | -> | Plus |
3L | 13047235..13047525 | 149..439 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13047024..13047171 | 1..148 | 99 | -> | Plus |
3L | 13047235..13047525 | 149..439 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13047024..13047171 | 1..148 | 99 | -> | Plus |
3L | 13047235..13047525 | 149..439 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 13040124..13040271 | 1..148 | 99 | -> | Plus |
arm_3L | 13040335..13040625 | 149..439 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13040335..13040625 | 149..439 | 99 | Plus | |
3L | 13040124..13040271 | 1..148 | 99 | -> | Plus |
Translation from 0 to 365
> GM21080.hyp LHSKTFIFRFLDKNLSFVKMPQGKFKKAKLPAAIQKKKNQKQAAFTRRSN APIQAKKAKFNETQKIKSVISKSVNKSVESELRSRAHEGYIQLSKAQEAV AKHHASQAKAAAAASTAKSAE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11279-PC | 102 | CG11279-PC | 1..102 | 20..121 | 492 | 100 | Plus |
CG11279-PB | 102 | CG11279-PB | 1..102 | 20..121 | 492 | 100 | Plus |
CG11279-PA | 102 | CG11279-PA | 1..102 | 20..121 | 492 | 100 | Plus |
Translation from 57 to 365
> GM21080.pep MPQGKFKKAKLPAAIQKKKNQKQAAFTRRSNAPIQAKKAKFNETQKIKSV ISKSVNKSVESELRSRAHEGYIQLSKAQEAVAKHHASQAKAAAAASTAKS AE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24029-PA | 101 | GF24029-PA | 1..81 | 1..81 | 342 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15625-PA | 102 | GG15625-PA | 1..102 | 1..102 | 490 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17145-PA | 103 | GH17145-PA | 1..82 | 1..81 | 342 | 91.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11279-PC | 102 | CG11279-PC | 1..102 | 1..102 | 492 | 100 | Plus |
CG11279-PB | 102 | CG11279-PB | 1..102 | 1..102 | 492 | 100 | Plus |
CG11279-PA | 102 | CG11279-PA | 1..102 | 1..102 | 492 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11754-PA | 100 | GI11754-PA | 1..98 | 1..97 | 369 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25333-PA | 107 | GL25333-PA | 1..84 | 1..85 | 388 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10885-PA | 105 | GA10885-PA | 1..84 | 1..85 | 388 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25396-PA | 102 | GM25396-PA | 1..102 | 1..102 | 493 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14428-PA | 102 | GD14428-PA | 1..102 | 1..102 | 490 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13464-PA | 107 | GJ13464-PA | 1..89 | 1..88 | 366 | 87.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17428-PA | 103 | GK17428-PA | 1..82 | 1..81 | 361 | 90.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21950-PA | 102 | GE21950-PA | 1..102 | 1..102 | 490 | 99 | Plus |