Clone GM21150 Report

Search the DGRC for GM21150

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:211
Well:50
Vector:pOT2
Associated Gene/TranscriptCG2200-RA
Protein status:GM21150.pep: gold
Preliminary Size:805
Sequenced Size:1027

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2200 2002-01-01 Sim4 clustering to Release 2
CG2200 2002-05-18 Blastp of sequenced clone
CG2200 2003-01-01 Sim4 clustering to Release 3
CG2200 2008-04-29 Release 5.5 accounting
CG2200 2008-08-15 Release 5.9 accounting
CG2200 2008-12-18 5.12 accounting

Clone Sequence Records

GM21150.complete Sequence

1027 bp (1027 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118855

> GM21150.complete
TCGACTGGCTGAACCATCCAGTGAACCATCCATTGGCCCACGATTAGATT
GCTAAAGAAATGGCCAGTGCACGGAACCTATTGTTGCTATCCTCGTCGCG
TTTGCACGGCCATGGATACTTGGAGCATGCGCGCGGCCAGCTGGAGGATC
TCTTCAAGAGTGCCAATGTGAAGACCGTGCTCTTTGTGCCCTACGCTCTG
CGGGATCACGACAAGTACACTGCCACCGTGCGCGATGCACTGCAGCCGTG
GGGATTCAATGTGGAGGGACTGCACACGAAGCCGGATCGCGAGCAGGCAT
TGCGGGAGGCACAGGCCATCTTTGTGGGCGGCGGCAACACCTTTGTGCTG
CTGCGTTCGCTCTACGAGATGAAGTTGCTCGATCCGATTAGGGAACTGGT
GCTCCAGCGTGGATTGCCTTACGTGGGCAGCAGTGCGGGCACAAATGTGG
CAACTCGATCCATTCACACCACCAACGACATGCCGGTGGCCTATCCGCCG
AGCTTTGAGGCACTCGCCCTCGTTCCCTTCAACATCAATCCGCACTATCT
GGATCCGGAGGCGGGTAGTCGGCACAAGGGCGAGACGCGAGACGAGCGGC
TGGAGGAGTTCGTCGCATACCATGGACTGCCCGTGCTGGGTCTTCGCGAG
GGCACCAGTGTCCGGGTTCAGGGCGAGAAGGCCATCCTCCTGGGCGATCG
CAATGCCAAGCTGTTCAAGGCTGACGGTGGCACCGAGGAGCTAGCACCCC
TAGCGGATCTCACCTTCCTGCTGCAGAAATAACCAAGCAAAACGATCGAA
TTAAAGAGAACATTGATGTTTATTGTACATATGCACATTCATAATTTGTT
TTATTCTGCAATAACAACAATTCCTACACGTAAGCAGTACACATACAGTA
GTTGTACACTATGACTAAATGTATAAAAAGTTTGGATAGAGGTATAACCC
CTGACGAGTGTACATATATCTAATAAATTTTGTAATAAATTAATCGGATT
TCCCCTCGTAAAAAAAAAAAAAAAAAA

GM21150.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG2200-RA 1402 CG2200-RA 265..1276 1..1012 5060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 12985725..12986287 159..721 2785 99.6 Plus
chrX 22417052 chrX 12986398..12986685 722..1009 1440 100 Plus
chrX 22417052 chrX 12985468..12985627 1..160 800 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13094771..13095333 159..721 2815 100 Plus
X 23542271 X 13095445..13095735 722..1012 1455 100 Plus
X 23542271 X 13094514..13094673 1..160 800 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13102869..13103431 159..721 2815 100 Plus
X 23527363 X 13103543..13103833 722..1012 1455 100 Plus
X 23527363 X 13102612..13102771 1..160 800 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:59:25 has no hits.

GM21150.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:00:23 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 12985468..12985627 1..160 100 -> Plus
chrX 12985727..12986287 161..721 99 -> Plus
chrX 12986398..12986685 722..1009 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:05 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
CG2200-RA 1..723 60..782 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:20 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
CG2200-RA 1..723 60..782 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:39 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
CG2200-RA 1..723 60..782 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:37:34 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
CG2200-RA 1..723 60..782 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:24:14 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
CG2200-RA 1..723 60..782 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:20:38 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
CG2200-RA 1..1009 1..1009 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:20 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
CG2200-RA 1..1009 1..1009 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:39 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
CG2200-RA 47..1055 1..1009 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:37:34 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
CG2200-RA 1..1009 1..1009 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:24:14 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
CG2200-RA 47..1055 1..1009 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:23 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
X 13094514..13094673 1..160 100 -> Plus
X 13094773..13095333 161..721 100 -> Plus
X 13095445..13095732 722..1009 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:23 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
X 13094514..13094673 1..160 100 -> Plus
X 13094773..13095333 161..721 100 -> Plus
X 13095445..13095732 722..1009 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:23 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
X 13094514..13094673 1..160 100 -> Plus
X 13094773..13095333 161..721 100 -> Plus
X 13095445..13095732 722..1009 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:39 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12988547..12988706 1..160 100 -> Plus
arm_X 12988806..12989366 161..721 100 -> Plus
arm_X 12989478..12989765 722..1009 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:09:56 Download gff for GM21150.complete
Subject Subject Range Query Range Percent Splice Strand
X 13102871..13103431 161..721 100 -> Plus
X 13103543..13103830 722..1009 100   Plus
X 13102612..13102771 1..160 100 -> Plus

GM21150.pep Sequence

Translation from 59 to 781

> GM21150.pep
MASARNLLLLSSSRLHGHGYLEHARGQLEDLFKSANVKTVLFVPYALRDH
DKYTATVRDALQPWGFNVEGLHTKPDREQALREAQAIFVGGGNTFVLLRS
LYEMKLLDPIRELVLQRGLPYVGSSAGTNVATRSIHTTNDMPVAYPPSFE
ALALVPFNINPHYLDPEAGSRHKGETRDERLEEFVAYHGLPVLGLREGTS
VRVQGEKAILLGDRNAKLFKADGGTEELAPLADLTFLLQK*

GM21150.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21404-PA 240 GF21404-PA 1..240 1..240 1098 90 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17754-PA 240 GG17754-PA 1..240 1..240 1166 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24433-PA 240 GH24433-PA 1..239 1..239 958 79.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG2200-PB 240 CG2200-PB 1..240 1..240 1235 100 Plus
CG2200-PA 240 CG2200-PA 1..240 1..240 1235 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16292-PA 241 GI16292-PA 3..241 2..240 961 78.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16520-PA 240 GL16520-PA 2..239 3..240 881 71 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15297-PA 240 GA15297-PA 2..239 3..240 1024 80.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11600-PA 240 GM11600-PA 1..240 1..240 1241 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24804-PA 240 GD24804-PA 1..240 1..240 1245 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16531-PA 241 GJ16531-PA 3..240 2..239 958 79.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25672-PA 240 GK25672-PA 2..238 3..239 966 80.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17042-PA 240 GE17042-PA 1..240 1..240 1157 95.4 Plus

GM21150.hyp Sequence

Translation from 59 to 781

> GM21150.hyp
MASARNLLLLSSSRLHGHGYLEHARGQLEDLFKSANVKTVLFVPYALRDH
DKYTATVRDALQPWGFNVEGLHTKPDREQALREAQAIFVGGGNTFVLLRS
LYEMKLLDPIRELVLQRGLPYVGSSAGTNVATRSIHTTNDMPVAYPPSFE
ALALVPFNINPHYLDPEAGSRHKGETRDERLEEFVAYHGLPVLGLREGTS
VRVQGEKAILLGDRNAKLFKADGGTEELAPLADLTFLLQK*

GM21150.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG2200-PB 240 CG2200-PB 1..240 1..240 1235 100 Plus
CG2200-PA 240 CG2200-PA 1..240 1..240 1235 100 Plus