Clone GM22210 Report

Search the DGRC for GM22210

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:222
Well:10
Vector:pOT2
Associated Gene/Transcriptox-RA
Protein status:GM22210.pep: gold
Sequenced Size:320

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lost to the ancients 2009-01-15 I'm sure there was a reason

Clone Sequence Records

GM22210.complete Sequence

320 bp assembled on 2009-01-15

GenBank Submission: BT058010.1

> GM22210.complete
CTGTGAGTTTGGCGTGTGGAAAAAGTTTGATTGGGAACAAATCGGACGTC
TTTAACAAAAATCTAGCCAACATGAAGGTTATCTACAACACCCTGTTCAA
GCGCACCTCCACCTACGCCGTGGCCATCATCGCGTCGGCCTTTTTCTTCG
AGCGCGCTCTCGATGTCACGTCGGTTGCGATTTTCGAGGGCATCAACAAA
GGCAAACTCTGGAAGGACATCAAGGGCAAATACGAATAAATTAACATGAT
TTGTTGTAATTAGCAATAATAATCAACGTTTATTCTAAACGAAACGATAA
CTAAAAAAAAAAAAAAAAAA

GM22210.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
ox-RA 380 ox-RA 45..348 1..304 1520 100 Plus
mRpL18-RA 775 mRpL18-RA 733..775 304..262 215 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8644499..8644701 203..1 1015 100 Minus
chr2R 21145070 chr2R 8644338..8644432 302..204 400 96 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12757298..12757500 203..1 1015 100 Minus
2R 25286936 2R 12757131..12757231 304..204 505 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12758497..12758699 203..1 1015 100 Minus
2R 25260384 2R 12758330..12758430 304..204 505 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:02:54 has no hits.

GM22210.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:03:36 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8644338..8644432 204..302 95 <- Minus
chr2R 8644499..8644701 1..203 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:59:11 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 1..168 72..239 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:38 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 1..168 72..239 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:00:18 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 1..168 72..239 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:24:46 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 1..168 72..239 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-15 12:14:13 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 24..325 1..302 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:38 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 24..319 1..296 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:00:18 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 30..331 1..302 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:24:46 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 30..331 1..302 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:03:36 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12757133..12757231 204..302 100 <- Minus
2R 12757298..12757500 1..203 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:03:36 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12757133..12757231 204..302 100 <- Minus
2R 12757298..12757500 1..203 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:03:36 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12757133..12757231 204..302 100 <- Minus
2R 12757298..12757500 1..203 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:00:18 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8644803..8645005 1..203 100   Minus
arm_2R 8644638..8644736 204..302 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:01:25 Download gff for GM22210.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12758497..12758699 1..203 100   Minus
2R 12758332..12758430 204..302 100 <- Minus

GM22210.pep Sequence

Translation from 2 to 238

> GM22210.pep
VSLACGKSLIGNKSDVFNKNLANMKVIYNTLFKRTSTYAVAIIASAFFFE
RALDVTSVAIFEGINKGKLWKDIKGKYE*

GM22210.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13094-PA 55 GF13094-PA 1..55 24..78 250 89.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22552-PA 55 GG22552-PA 1..55 24..78 274 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19952-PA 55 GH19952-PA 1..55 24..78 239 83.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:26
Subject Length Description Subject Range Query Range Score Percent Strand
ox-PA 55 CG8764-PA 1..55 24..78 277 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19909-PA 55 GI19909-PA 1..55 24..78 241 85.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17726-PA 55 GL17726-PA 1..55 24..78 243 83.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21302-PA 55 GA21302-PA 1..55 24..78 243 83.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20336-PA 55 GM20336-PA 1..55 24..78 278 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25813-PA 55 GD25813-PA 1..55 24..78 278 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15078-PA 55 GJ15078-PA 1..55 24..78 248 89.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21685-PA 55 GK21685-PA 1..55 24..78 246 87.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\ox-PA 55 GE13422-PA 1..55 24..78 275 98.2 Plus

GM22210.hyp Sequence

Translation from 2 to 238

> GM22210.hyp
VSLACGKSLIGNKSDVFNKNLANMKVIYNTLFKRTSTYAVAIIASAFFFE
RALDVTSVAIFEGINKGKLWKDIKGKYE*

GM22210.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
ox-PA 55 CG8764-PA 1..55 24..78 277 100 Plus