Clone GM22884 Report

Search the DGRC for GM22884

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:228
Well:84
Vector:pOT2
Associated Gene/TranscriptCG18624-RA
Protein status:GM22884.pep: gold
Sequenced Size:518

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lost to the ancients 2009-01-15 I'm sure there was a reason

Clone Sequence Records

GM22884.complete Sequence

518 bp assembled on 2009-01-15

GenBank Submission: BT056320.1

> GM22884.complete
CGACAGCCCTGGTGCTATCGATGCTATAAACCTATGGGCAGTGGGATTGT
GGTTCAATTGGCTCGAAAGTACGGCGCAGTGATATTCTTTCCCACTGTTG
CAGTCGGATCGATTTACGCAGATTGGTCGCACACCCGCCAGTGGAAACGC
CAGCAGCTCCAGTTGGCACACCGAGCCCAGCTGAAGGATCAGCACTAAGA
GGATACACAAATATACACCATGGTCTTGGGACTGGATAAGCGAGCACTGT
GGGGCGCGTTGCCCCTGCTGGGATTTGCCATTGGCCACTTCCTGGACAAG
AAGGAAACGGAACGTATGACCATGTTCCGGGACAAGAGTGCCCTATACGG
CCGTCCCGCCGGCAGCGAGGGTAAGGCGCCATCCTGGTAGGCCTGCCCAA
CATCGCCATCCCAAAATATTATTTTTTTTCCCCCAATTCACTGTTATTCA
ATAAACCGGAGAAATGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

GM22884.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG18624-RA 728 CG18624-RA 96..566 1..471 2340 99.7 Plus
CG18624-RD 821 CG18624-RD 218..659 30..471 2195 99.7 Plus
CG18624-RB 509 CG18624-RB 72..509 30..467 2175 99.7 Plus
CG18624-RD 821 CG18624-RD 27..55 1..29 145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7784951..7785389 468..30 2195 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7893049..7893490 471..30 2195 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7901147..7901588 471..30 2195 99.7 Minus
X 23527363 X 7901848..7901876 29..1 145 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:04:03 has no hits.

GM22884.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:04:50 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7784951..7785389 30..468 100 <- Minus
chrX 7785649..7785677 1..29 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:59:12 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RB 1..171 220..390 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:39 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RC 1..171 220..390 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:45 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RE 1..171 220..390 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:55:56 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RE 1..171 220..390 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-15 12:31:44 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RA 19..486 1..468 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:39 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RA 19..485 1..467 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:45 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RA 21..487 1..467 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:55:56 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
CG45089-RA 21..487 1..467 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:50 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
X 7893052..7893490 30..468 99 <- Minus
X 7893750..7893778 1..29 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:50 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
X 7893052..7893490 30..468 99 <- Minus
X 7893750..7893778 1..29 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:50 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
X 7893052..7893490 30..468 99 <- Minus
X 7893750..7893778 1..29 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:45 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7787085..7787523 30..468 99 <- Minus
arm_X 7787783..7787811 1..29 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:01:26 Download gff for GM22884.complete
Subject Subject Range Query Range Percent Splice Strand
X 7901150..7901588 30..468 99 <- Minus
X 7901848..7901876 1..29 100   Minus

GM22884.hyp Sequence

Translation from 0 to 197

> GM22884.hyp
RQPWCYRCYKPMGSGIVVQLARKYGAVIFFPTVAVGSIYADWSHTRQWKR
QQLQLAHRAQLKDQR*

GM22884.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG45089-PC 54 CG45089-PC 1..54 12..65 281 100 Plus
CG45089-PB 54 CG45089-PB 1..54 12..65 281 100 Plus
CG45089-PA 54 CG45089-PA 1..54 12..65 281 100 Plus

GM22884.pep Sequence

Translation from 219 to 389

> GM22884.pep
MVLGLDKRALWGALPLLGFAIGHFLDKKETERMTMFRDKSALYGRPAGSE
GKAPSW*

GM22884.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21240-PA 55 GF21240-PA 1..55 1..56 247 89.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17601-PA 56 GG17601-PA 1..56 1..56 274 94.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24477-PA 56 GH24477-PA 1..56 1..56 257 89.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
ND-MNLL-PD 56 CG18624-PD 1..56 1..56 297 100 Plus
ND-MNLL-PC 56 CG18624-PC 1..56 1..56 297 100 Plus
ND-MNLL-PE 56 CG18624-PE 1..56 1..56 297 100 Plus
ND-MNLL-PB 56 CG18624-PB 1..56 1..56 297 100 Plus
ND-MNLL-PA 56 CG18624-PA 1..56 1..56 297 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11216-PA 55 GI11216-PA 1..55 1..56 252 91.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14582-PA 56 GL14582-PA 1..56 1..56 254 83.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15019-PA 56 GA15019-PA 1..56 1..56 254 83.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16858-PA 56 GJ16858-PA 1..56 1..56 267 91.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18864-PA 56 GK18864-PA 1..56 1..56 248 83.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17501-PA 56 GE17501-PA 1..56 1..56 279 96.4 Plus