Clone GM23292 Report

Search the DGRC for GM23292

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:232
Well:92
Vector:pOT2
Associated Gene/Transcriptl(2)35Di-RA
Protein status:GM23292.pep: gold
Sequenced Size:710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13240 2002-11-11 Blastp of sequenced clone
l(2)35Di 2008-04-29 Release 5.5 accounting
l(2)35Di 2008-08-15 Release 5.9 accounting
l(2)35Di 2008-12-18 5.12 accounting

Clone Sequence Records

GM23292.complete Sequence

710 bp (710 high quality bases) assembled on 2002-11-11

GenBank Submission: BT001463

> GM23292.complete
TCGCTGTCCGATTAAATTATACAATTGTTGGCGTTTTCCAACGTCCACAT
CGCAAAGTTCGAAAACAAACGGTCCAAAATGGTAGCTGGTGGTGCCTCGG
AAACGGGCGGCGTGAAGCCGATGGTAATTGCGGGCCGCATGGTGCGGGAG
CGGGAGCGCCTGATCGGCATGTCGCCGGAGGAGCGCGCCTGGCGCAAACA
GTGGCTGAAGGACCAGGAGCTGCACCATGGACCCCGCAAGGTGCCCGCCC
TGGAGCTGGAGCTGAACAACCCCATCAAGCGCTTCTACCGCGCTCCCCTC
GACAAGGTCTGCAATGTTTTGGAACCCGTCCTGGGCTTTCAGCGCGCGTA
CACCGTGCGCTTCTGGACCGGAAAGGCTCTGCTCGCCCTAACCGGAATCT
ACGCCGGCGCCTACTACTTCAAGTACAATCAGAATGACTGGACCCGGAAG
GGCGGCTGGCGTGTGATCCACTCGCGCAAGCAGTGCGTGCCCGGAGATGA
GGGCTATCCCAAGGTCTCCGATCGATCGGCGCCTTCCGATTACGCGGCTC
GCGGATTCAACGAGTCGCCGCTGAAAGCTTGAAGAGATGATCGTCCCCGA
GCTGGCTTAGTGATTTTGCTTAAGTTTGAAACGTAAAATTAATAATATCA
AAACAAAAATCGCAATAAATATGGAAACGAAAACACAAAAAAAAAAAAAA
AAAAAAAAAA

GM23292.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)35Di-RA 901 l(2)35Di-RA 102..790 1..689 3400 99.5 Plus
l(2)35Di-RB 736 l(2)35Di-RB 73..508 1..436 2150 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15749436..15749769 334..1 1655 99.7 Minus
chr2L 23010047 chr2L 15748317..15748567 686..436 1255 100 Minus
chr2L 23010047 chr2L 15749264..15749367 436..333 520 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15750721..15751054 334..1 1655 99.7 Minus
2L 23513712 2L 15749598..15749851 689..436 1255 99.6 Minus
2L 23513712 2L 15750549..15750652 436..333 505 99 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15750721..15751054 334..1 1655 99.7 Minus
2L 23513712 2L 15749598..15749851 689..436 1255 99.6 Minus
2L 23513712 2L 15750549..15750652 436..333 505 99 Minus
Blast to na_te.dros performed on 2019-03-16 13:15:49 has no hits.

GM23292.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:16:40 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15748317..15748567 436..686 100 <- Minus
chr2L 15749265..15749366 334..435 100 <- Minus
chr2L 15749437..15749769 1..333 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:11 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 1..504 79..582 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:56 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 1..504 79..582 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:57:48 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 1..504 79..582 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:32:04 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 1..504 79..582 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:11:38 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 1..504 79..582 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:00:36 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 1..678 1..678 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:56 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 1..678 1..678 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:57:48 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 25..710 1..686 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:32:04 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 1..678 1..678 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:11:38 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 25..710 1..686 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:16:40 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15749601..15749851 436..686 99 <- Minus
2L 15750550..15750651 334..435 99 <- Minus
2L 15750722..15751054 1..333 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:16:40 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15749601..15749851 436..686 99 <- Minus
2L 15750550..15750651 334..435 99 <- Minus
2L 15750722..15751054 1..333 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:16:40 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15749601..15749851 436..686 99 <- Minus
2L 15750550..15750651 334..435 99 <- Minus
2L 15750722..15751054 1..333 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:57:48 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15749601..15749851 436..686 99 <- Minus
arm_2L 15750550..15750651 334..435 99 <- Minus
arm_2L 15750722..15751054 1..333 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:11:44 Download gff for GM23292.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15749601..15749851 436..686 99 <- Minus
2L 15750550..15750651 334..435 99 <- Minus
2L 15750722..15751054 1..333 99   Minus

GM23292.pep Sequence

Translation from 78 to 581

> GM23292.pep
MVAGGASETGGVKPMVIAGRMVRERERLIGMSPEERAWRKQWLKDQELHH
GPRKVPALELELNNPIKRFYRAPLDKVCNVLEPVLGFQRAYTVRFWTGKA
LLALTGIYAGAYYFKYNQNDWTRKGGWRVIHSRKQCVPGDEGYPKVSDRS
APSDYAARGFNESPLKA*

GM23292.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14976-PA 165 GF14976-PA 1..165 1..165 805 89.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24196-PA 167 GG24196-PA 1..167 1..167 873 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13252-PA 165 GH13252-PA 1..165 1..165 812 88.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B17-PC 167 CG13240-PC 1..167 1..167 901 100 Plus
ND-B17-PA 167 CG13240-PA 1..167 1..167 901 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17291-PA 165 GI17291-PA 1..163 1..163 785 88.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15438-PA 165 GL15438-PA 1..165 1..165 808 89.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12146-PA 165 GA12146-PA 1..165 1..165 811 89.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14221-PA 167 GM14221-PA 1..167 1..167 879 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21943-PA 167 GD21943-PA 1..167 1..167 879 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17901-PA 165 GJ17901-PA 1..165 1..165 808 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24273-PA 165 GK24273-PA 1..165 1..165 823 91.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19391-PA 167 GE19391-PA 1..167 1..167 871 97.6 Plus

GM23292.hyp Sequence

Translation from 78 to 581

> GM23292.hyp
MVAGGASETGGVKPMVIAGRMVRERERLIGMSPEERAWRKQWLKDQELHH
GPRKVPALELELNNPIKRFYRAPLDKVCNVLEPVLGFQRAYTVRFWTGKA
LLALTGIYAGAYYFKYNQNDWTRKGGWRVIHSRKQCVPGDEGYPKVSDRS
APSDYAARGFNESPLKA*

GM23292.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)35Di-PC 167 CG13240-PC 1..167 1..167 901 100 Plus
l(2)35Di-PA 167 CG13240-PA 1..167 1..167 901 100 Plus