BDGP Sequence Production Resources |
Search the DGRC for GM23292
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 232 |
Well: | 92 |
Vector: | pOT2 |
Associated Gene/Transcript | l(2)35Di-RA |
Protein status: | GM23292.pep: gold |
Sequenced Size: | 710 |
Gene | Date | Evidence |
---|---|---|
CG13240 | 2002-11-11 | Blastp of sequenced clone |
l(2)35Di | 2008-04-29 | Release 5.5 accounting |
l(2)35Di | 2008-08-15 | Release 5.9 accounting |
l(2)35Di | 2008-12-18 | 5.12 accounting |
710 bp (710 high quality bases) assembled on 2002-11-11
GenBank Submission: BT001463
> GM23292.complete TCGCTGTCCGATTAAATTATACAATTGTTGGCGTTTTCCAACGTCCACAT CGCAAAGTTCGAAAACAAACGGTCCAAAATGGTAGCTGGTGGTGCCTCGG AAACGGGCGGCGTGAAGCCGATGGTAATTGCGGGCCGCATGGTGCGGGAG CGGGAGCGCCTGATCGGCATGTCGCCGGAGGAGCGCGCCTGGCGCAAACA GTGGCTGAAGGACCAGGAGCTGCACCATGGACCCCGCAAGGTGCCCGCCC TGGAGCTGGAGCTGAACAACCCCATCAAGCGCTTCTACCGCGCTCCCCTC GACAAGGTCTGCAATGTTTTGGAACCCGTCCTGGGCTTTCAGCGCGCGTA CACCGTGCGCTTCTGGACCGGAAAGGCTCTGCTCGCCCTAACCGGAATCT ACGCCGGCGCCTACTACTTCAAGTACAATCAGAATGACTGGACCCGGAAG GGCGGCTGGCGTGTGATCCACTCGCGCAAGCAGTGCGTGCCCGGAGATGA GGGCTATCCCAAGGTCTCCGATCGATCGGCGCCTTCCGATTACGCGGCTC GCGGATTCAACGAGTCGCCGCTGAAAGCTTGAAGAGATGATCGTCCCCGA GCTGGCTTAGTGATTTTGCTTAAGTTTGAAACGTAAAATTAATAATATCA AAACAAAAATCGCAATAAATATGGAAACGAAAACACAAAAAAAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 15749436..15749769 | 334..1 | 1655 | 99.7 | Minus |
chr2L | 23010047 | chr2L | 15748317..15748567 | 686..436 | 1255 | 100 | Minus |
chr2L | 23010047 | chr2L | 15749264..15749367 | 436..333 | 520 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 15750721..15751054 | 334..1 | 1655 | 99.7 | Minus |
2L | 23513712 | 2L | 15749598..15749851 | 689..436 | 1255 | 99.6 | Minus |
2L | 23513712 | 2L | 15750549..15750652 | 436..333 | 505 | 99 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 15750721..15751054 | 334..1 | 1655 | 99.7 | Minus |
2L | 23513712 | 2L | 15749598..15749851 | 689..436 | 1255 | 99.6 | Minus |
2L | 23513712 | 2L | 15750549..15750652 | 436..333 | 505 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 15748317..15748567 | 436..686 | 100 | <- | Minus |
chr2L | 15749265..15749366 | 334..435 | 100 | <- | Minus |
chr2L | 15749437..15749769 | 1..333 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)35Di-RA | 1..504 | 79..582 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)35Di-RA | 1..504 | 79..582 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)35Di-RA | 1..504 | 79..582 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)35Di-RA | 1..504 | 79..582 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)35Di-RA | 1..504 | 79..582 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)35Di-RA | 1..678 | 1..678 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)35Di-RA | 1..678 | 1..678 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)35Di-RA | 25..710 | 1..686 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)35Di-RA | 1..678 | 1..678 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)35Di-RA | 25..710 | 1..686 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15749601..15749851 | 436..686 | 99 | <- | Minus |
2L | 15750550..15750651 | 334..435 | 99 | <- | Minus |
2L | 15750722..15751054 | 1..333 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15749601..15749851 | 436..686 | 99 | <- | Minus |
2L | 15750550..15750651 | 334..435 | 99 | <- | Minus |
2L | 15750722..15751054 | 1..333 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15749601..15749851 | 436..686 | 99 | <- | Minus |
2L | 15750550..15750651 | 334..435 | 99 | <- | Minus |
2L | 15750722..15751054 | 1..333 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 15749601..15749851 | 436..686 | 99 | <- | Minus |
arm_2L | 15750550..15750651 | 334..435 | 99 | <- | Minus |
arm_2L | 15750722..15751054 | 1..333 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15749601..15749851 | 436..686 | 99 | <- | Minus |
2L | 15750550..15750651 | 334..435 | 99 | <- | Minus |
2L | 15750722..15751054 | 1..333 | 99 | Minus |
Translation from 78 to 581
> GM23292.pep MVAGGASETGGVKPMVIAGRMVRERERLIGMSPEERAWRKQWLKDQELHH GPRKVPALELELNNPIKRFYRAPLDKVCNVLEPVLGFQRAYTVRFWTGKA LLALTGIYAGAYYFKYNQNDWTRKGGWRVIHSRKQCVPGDEGYPKVSDRS APSDYAARGFNESPLKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14976-PA | 165 | GF14976-PA | 1..165 | 1..165 | 805 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24196-PA | 167 | GG24196-PA | 1..167 | 1..167 | 873 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13252-PA | 165 | GH13252-PA | 1..165 | 1..165 | 812 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ND-B17-PC | 167 | CG13240-PC | 1..167 | 1..167 | 901 | 100 | Plus |
ND-B17-PA | 167 | CG13240-PA | 1..167 | 1..167 | 901 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17291-PA | 165 | GI17291-PA | 1..163 | 1..163 | 785 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15438-PA | 165 | GL15438-PA | 1..165 | 1..165 | 808 | 89.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12146-PA | 165 | GA12146-PA | 1..165 | 1..165 | 811 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14221-PA | 167 | GM14221-PA | 1..167 | 1..167 | 879 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21943-PA | 167 | GD21943-PA | 1..167 | 1..167 | 879 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17901-PA | 165 | GJ17901-PA | 1..165 | 1..165 | 808 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24273-PA | 165 | GK24273-PA | 1..165 | 1..165 | 823 | 91.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19391-PA | 167 | GE19391-PA | 1..167 | 1..167 | 871 | 97.6 | Plus |
Translation from 78 to 581
> GM23292.hyp MVAGGASETGGVKPMVIAGRMVRERERLIGMSPEERAWRKQWLKDQELHH GPRKVPALELELNNPIKRFYRAPLDKVCNVLEPVLGFQRAYTVRFWTGKA LLALTGIYAGAYYFKYNQNDWTRKGGWRVIHSRKQCVPGDEGYPKVSDRS APSDYAARGFNESPLKA*