Clone GM23968 Report

Search the DGRC for GM23968

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:239
Well:68
Vector:pOT2
Associated Gene/TranscriptSmF-RA
Protein status:GM23968.pep: gold
Preliminary Size:422
Sequenced Size:450

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16792 2002-01-01 Sim4 clustering to Release 2
CG16792 2002-05-18 Blastp of sequenced clone
CG16792 2003-01-01 Sim4 clustering to Release 3
DebB 2008-04-29 Release 5.5 accounting
DebB 2008-08-15 Release 5.9 accounting
DebB 2008-12-18 5.12 accounting

Clone Sequence Records

GM23968.complete Sequence

450 bp (450 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118862

> GM23968.complete
AAAAAAACGCGAAAAGCCGGCGATTTTCGGCACGCTTGTTGTAATATTTT
ATAAAAAAGGCAGGAAAAATCAAATAAACAGAATGTCGGCTGGTATGCCC
ATTAACCCCAAGCCCTTCCTGAACGGCCTGACGGGAAAACCGGTGCTGGT
GAAGCTGAAGTGGGGCCAGGAGTACAAGGGCTTCCTGGTCTCCGTCGACG
GCTACATGAACATGCAGCTGGCGAACACGGAGGAAGTGATCGAGGGCTCC
GTGACTGGTAATCTTGGCGAGGTGCTCATCCGCTGCAACAACGTGCTGTA
TATCAAGGGCATGGAGGACGACGACGAGGAGGGCGAAATGCGCGACTAGC
CAATGGATTCACCTACATACACCCACACCTTACTTCTAAGTCTACAAACG
TAATGAAATAAAGCTAACTTTATTTTGTAAAAAAAAAAAAAAAAAAAAAA

GM23968.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
DebB-RA 430 DebB-RA 3..430 1..428 2140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8071059..8071486 428..1 2140 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12183842..12184271 430..1 2150 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12185041..12185470 430..1 2150 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:00:32 has no hits.

GM23968.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:01:17 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8071059..8071486 1..428 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:15 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
DebB-RA 1..267 83..349 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:15 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
SmF-RA 1..267 83..349 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:05:34 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
SmF-RA 1..267 83..349 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:17 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
DebB-RA 1..267 83..349 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:09:23 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
SmF-RA 1..267 83..349 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:59:34 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
DebB-RA 3..428 1..426 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:14 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
SmF-RA 3..430 1..428 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:05:34 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
SmF-RA 40..467 1..428 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:18 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
DebB-RA 3..428 1..426 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:09:23 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
SmF-RA 40..467 1..428 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:01:17 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12183844..12184271 1..428 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:01:17 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12183844..12184271 1..428 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:01:17 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12183844..12184271 1..428 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:05:34 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8071349..8071776 1..428 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:33 Download gff for GM23968.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12185043..12185470 1..428 100   Minus

GM23968.hyp Sequence

Translation from 0 to 348

> GM23968.hyp
KKREKPAIFGTLVVIFYKKGRKNQINRMSAGMPINPKPFLNGLTGKPVLV
KLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCNNVLY
IKGMEDDDEEGEMRD*

GM23968.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
SmF-PA 88 CG16792-PA 1..88 28..115 463 100 Plus
CG9344-PA 79 CG9344-PA 10..72 39..101 161 49.2 Plus

GM23968.pep Sequence

Translation from 82 to 348

> GM23968.pep
MSAGMPINPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTE
EVIEGSVTGNLGEVLIRCNNVLYIKGMEDDDEEGEMRD*

GM23968.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12081-PA 88 GF12081-PA 1..88 1..88 454 100 Plus
Dana\GF12211-PA 79 GF12211-PA 10..72 12..74 160 49.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22599-PA 88 GG22599-PA 1..88 1..88 454 100 Plus
Dere\GG22072-PA 79 GG22072-PA 10..72 12..74 160 49.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22983-PA 88 GH22983-PA 1..88 1..88 454 100 Plus
Dgri\GH22008-PA 79 GH22008-PA 10..72 12..74 162 49.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
SmF-PA 88 CG16792-PA 1..88 1..88 463 100 Plus
CG9344-PA 79 CG9344-PA 10..72 12..74 161 49.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18952-PA 88 GI18952-PA 1..88 1..88 454 100 Plus
Dmoj\GI19714-PA 79 GI19714-PA 10..72 12..74 162 49.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11267-PA 88 GL11267-PA 1..88 1..88 454 100 Plus
Dper\GL17007-PA 79 GL17007-PA 10..72 12..74 160 49.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14154-PA 88 GA14154-PA 1..88 1..88 454 100 Plus
Dpse\GA21716-PA 79 GA21716-PA 10..72 12..74 160 49.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20378-PA 88 GM20378-PA 1..88 1..88 454 100 Plus
Dsec\GM15790-PA 79 GM15790-PA 10..72 12..74 160 49.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\DebB-PA 88 GD15242-PA 1..88 1..88 454 100 Plus
Dsim\GD15243-PA 88 GD15243-PA 1..88 1..88 454 100 Plus
Dsim\GD11551-PA 79 GD11551-PA 10..72 12..74 160 49.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21558-PA 88 GJ21558-PA 1..88 1..88 454 100 Plus
Dvir\GJ17501-PA 79 GJ17501-PA 10..72 12..74 162 49.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22120-PA 88 GK22120-PA 1..88 1..88 454 100 Plus
Dwil\GK23338-PA 79 GK23338-PA 10..72 12..74 160 49.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13467-PA 88 GE13467-PA 1..88 1..88 454 100 Plus
Dyak\GE12153-PA 79 GE12153-PA 10..72 12..74 160 49.2 Plus