Clone GM24338 Report

Search the DGRC for GM24338

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:243
Well:38
Vector:pOT2
Associated Gene/TranscriptCG32266-RA
Protein status:GM24338.pep: gold
Sequenced Size:547

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1120 2002-01-01 Sim4 clustering to Release 2
CG32266 2002-05-18 Blastp of sequenced clone
CG32266 2003-01-01 Sim4 clustering to Release 3
CG32266 2008-04-29 Release 5.5 accounting
CG32266 2008-08-15 Release 5.9 accounting
CG32266 2008-12-18 5.12 accounting

Clone Sequence Records

GM24338.complete Sequence

547 bp (547 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118863

> GM24338.complete
TTCAATCAGCGGATATACCACCAAAATCAATCAATTCAAGATGTTCAAGT
TTTTCGCTCTGTGCCTGTTCGCCCTGTTGGCCGTTGCCTGTGGCAAGCCG
CAATTCCTGACCGCCTACAGTGCGGCCTCGCCTGTGGTTGCTGCCACGCC
CTACGCCTACTCGGGCGGACTCTACGCACCCACGTACAGTGCTGCCTACA
CCAGCGGCGTCTATGCCGCCACGCCCTACGCCTACGGAGCCTATCCCTAC
AGCTCGCTGTACCTGAGACGCTGAAGTTCCCACACCAACGAATGCACACT
GTACAACGATAATTCCCGATGACGTCGAACTAATGAACAAATAAACCTGA
TAAAACAGATAAAGATTCGCATACCAAAGGCCAGCTATTTGCTGTCATTT
GCTTTGAGCAACTGCAGATTAAAAGGGGCTGCAAAATGAAAGTGGCATTG
GTCCTACACTCGCAGAAAAACACTTGTTAAATAATAGAAAAAAAAAAAAT
TAAACATACATAGCCATTGATTATCGAAAAAAAAAAAAAAAAAAAAA

GM24338.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-RA 595 CG32266-RA 53..581 1..529 2570 99 Plus
CG32266.a 500 CG32266.a 70..500 98..528 2080 98.8 Plus
CG32266.a 500 CG32266.a 18..69 1..52 260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3790483..3790955 53..526 2230 98.5 Plus
chr3L 24539361 chr3L 3790178..3790229 1..52 260 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3791087..3791563 53..529 2310 99 Plus
3L 28110227 3L 3790804..3790855 1..52 260 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3791087..3791563 53..529 2310 98.9 Plus
3L 28103327 3L 3790804..3790855 1..52 260 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:30:42 has no hits.

GM24338.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:31:31 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3790178..3790229 1..52 100 -> Plus
chr3L 3790483..3790955 53..526 93   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:49:59 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..234 41..274 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:45:05 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..234 41..274 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:30:46 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..234 41..274 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:32:58 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..234 41..274 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:23:15 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..526 1..526 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:49:58 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..526 1..526 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:45:05 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..526 1..526 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:30:46 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..526 1..526 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:32:58 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..526 1..526 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:31 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3790804..3790855 1..52 100 -> Plus
3L 3791087..3791560 53..526 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:31 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3790804..3790855 1..52 100 -> Plus
3L 3791087..3791560 53..526 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:31 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3790804..3790855 1..52 100 -> Plus
3L 3791087..3791560 53..526 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:45:05 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3790804..3790855 1..52 100 -> Plus
arm_3L 3791087..3791560 53..526 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:09 Download gff for GM24338.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3791087..3791560 53..526 98   Plus
3L 3790804..3790855 1..52 100 -> Plus

GM24338.hyp Sequence

Translation from 0 to 311

> GM24338.hyp
FNQRIYHQNQSIQDVQVFRSVPVRPVGRCLWQAAIPDRLQCGLACGCCHA
LRLLGRTLRTHVQCCLHQRRLCRHALRLRSLSLQLAVPETLKFPHHRMHT
VQR*
Sequence GM24338.hyp has no blast hits.

GM24338.pep Sequence

Translation from 40 to 273

> GM24338.pep
MFKFFALCLFALLAVACGKPQFLTAYSAASPVVAATPYAYSGGLYAPTYS
AAYTSGVYAATPYAYGAYPYSSLYLRR*

GM24338.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24222-PA 77 GF24222-PA 1..77 1..77 271 84.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15156-PA 76 GG15156-PA 1..76 1..77 338 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16424-PA 76 GH16424-PA 3..76 5..77 199 73.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-PA 77 CG32266-PA 1..77 1..77 403 100 Plus
CG13067-PA 79 CG13067-PA 1..78 1..74 150 50 Plus
CG13069-PA 97 CG13069-PA 1..79 1..70 135 40.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12505-PA 75 GI12505-PA 1..75 1..77 164 67.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23800-PA 79 GA23800-PA 1..79 1..77 237 78.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14585-PA 76 GM14585-PA 1..76 1..77 347 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13778-PA 76 GD13778-PA 1..76 1..77 347 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12412-PA 77 GJ12412-PA 1..77 1..77 148 65.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20522-PA 77 GK20522-PA 1..49 1..46 153 73.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21377-PA 77 GE21377-PA 1..77 1..77 271 85.9 Plus