BDGP Sequence Production Resources |
Search the DGRC for GM24338
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 243 |
Well: | 38 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32266-RA |
Protein status: | GM24338.pep: gold |
Sequenced Size: | 547 |
Gene | Date | Evidence |
---|---|---|
CG1120 | 2002-01-01 | Sim4 clustering to Release 2 |
CG32266 | 2002-05-18 | Blastp of sequenced clone |
CG32266 | 2003-01-01 | Sim4 clustering to Release 3 |
CG32266 | 2008-04-29 | Release 5.5 accounting |
CG32266 | 2008-08-15 | Release 5.9 accounting |
CG32266 | 2008-12-18 | 5.12 accounting |
547 bp (547 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118863
> GM24338.complete TTCAATCAGCGGATATACCACCAAAATCAATCAATTCAAGATGTTCAAGT TTTTCGCTCTGTGCCTGTTCGCCCTGTTGGCCGTTGCCTGTGGCAAGCCG CAATTCCTGACCGCCTACAGTGCGGCCTCGCCTGTGGTTGCTGCCACGCC CTACGCCTACTCGGGCGGACTCTACGCACCCACGTACAGTGCTGCCTACA CCAGCGGCGTCTATGCCGCCACGCCCTACGCCTACGGAGCCTATCCCTAC AGCTCGCTGTACCTGAGACGCTGAAGTTCCCACACCAACGAATGCACACT GTACAACGATAATTCCCGATGACGTCGAACTAATGAACAAATAAACCTGA TAAAACAGATAAAGATTCGCATACCAAAGGCCAGCTATTTGCTGTCATTT GCTTTGAGCAACTGCAGATTAAAAGGGGCTGCAAAATGAAAGTGGCATTG GTCCTACACTCGCAGAAAAACACTTGTTAAATAATAGAAAAAAAAAAAAT TAAACATACATAGCCATTGATTATCGAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 3790178..3790229 | 1..52 | 100 | -> | Plus |
chr3L | 3790483..3790955 | 53..526 | 93 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32266-RA | 1..234 | 41..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32266-RA | 1..234 | 41..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32266-RA | 1..234 | 41..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32266-RA | 1..234 | 41..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32266-RA | 1..526 | 1..526 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32266-RA | 1..526 | 1..526 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32266-RA | 1..526 | 1..526 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32266-RA | 1..526 | 1..526 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32266-RA | 1..526 | 1..526 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3790804..3790855 | 1..52 | 100 | -> | Plus |
3L | 3791087..3791560 | 53..526 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3790804..3790855 | 1..52 | 100 | -> | Plus |
3L | 3791087..3791560 | 53..526 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3790804..3790855 | 1..52 | 100 | -> | Plus |
3L | 3791087..3791560 | 53..526 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 3790804..3790855 | 1..52 | 100 | -> | Plus |
arm_3L | 3791087..3791560 | 53..526 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3791087..3791560 | 53..526 | 98 | Plus | |
3L | 3790804..3790855 | 1..52 | 100 | -> | Plus |
Translation from 0 to 311
> GM24338.hyp FNQRIYHQNQSIQDVQVFRSVPVRPVGRCLWQAAIPDRLQCGLACGCCHA LRLLGRTLRTHVQCCLHQRRLCRHALRLRSLSLQLAVPETLKFPHHRMHT VQR*
Translation from 40 to 273
> GM24338.pep MFKFFALCLFALLAVACGKPQFLTAYSAASPVVAATPYAYSGGLYAPTYS AAYTSGVYAATPYAYGAYPYSSLYLRR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24222-PA | 77 | GF24222-PA | 1..77 | 1..77 | 271 | 84.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15156-PA | 76 | GG15156-PA | 1..76 | 1..77 | 338 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16424-PA | 76 | GH16424-PA | 3..76 | 5..77 | 199 | 73.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32266-PA | 77 | CG32266-PA | 1..77 | 1..77 | 403 | 100 | Plus |
CG13067-PA | 79 | CG13067-PA | 1..78 | 1..74 | 150 | 50 | Plus |
CG13069-PA | 97 | CG13069-PA | 1..79 | 1..70 | 135 | 40.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12505-PA | 75 | GI12505-PA | 1..75 | 1..77 | 164 | 67.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23800-PA | 79 | GA23800-PA | 1..79 | 1..77 | 237 | 78.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14585-PA | 76 | GM14585-PA | 1..76 | 1..77 | 347 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13778-PA | 76 | GD13778-PA | 1..76 | 1..77 | 347 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12412-PA | 77 | GJ12412-PA | 1..77 | 1..77 | 148 | 65.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20522-PA | 77 | GK20522-PA | 1..49 | 1..46 | 153 | 73.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21377-PA | 77 | GE21377-PA | 1..77 | 1..77 | 271 | 85.9 | Plus |