BDGP Sequence Production Resources |
Search the DGRC for GM24606
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 246 |
Well: | 6 |
Vector: | pOT2 |
Associated Gene/Transcript | RpS21-RE |
Protein status: | GM24606.pep: gold |
Sequenced Size: | 437 |
Gene | Date | Evidence |
---|---|---|
oho23B-RE | 2010-11-11 | Gleaning Pick By Joe Carlson |
437 bp assembled on 2010-12-02
GenBank Submission: BT125796.1
> GM24606.complete CCGACGAGTTGCGGTCGCTAGATTTGTAAATTTCTACAAAAAACCCAATA AAATGGAGAACGACGCCGGTGAGAATGTTGATCTGTACGTGCCCCGCAAA TGCTCGGCGTCCAACAGGATCATCCACGCCAAGGATCACGCCTCCGTGCA GCTGAGCATCGTGGATGTGGACCCCGAGACCGGTCGCCAGACCGACGGTT CCAAGACCTACGCCATCTGCGGCGAGATCCGTCGCATGGGCGAGTCCGAC GACTGCATCGTGCGTCTGGCCAAGAAGGACGGCATCATTACCAAGTGAGT TTGTGCTAGAATCCCCGGGATGGACATCCACTAATCGCGCATTTTTCGCC TTGCAGGAACTTCTAAGTTCCCATAGCTAGATTTTGATTTGGTAATAAAG CGATTTCCCTTTGTAATTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 2856052..2856369 | 102..419 | 1575 | 99.7 | Plus |
chr2L | 23010047 | chr2L | 2855923..2855981 | 44..102 | 295 | 100 | Plus |
chr2L | 23010047 | chr2L | 2855809..2855851 | 1..43 | 215 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 2856376..2856641 | 102..367 | 1330 | 100 | Plus |
2L | 23513712 | 2L | 2856247..2856305 | 44..102 | 295 | 100 | Plus |
2L | 23513712 | 2L | 2856651..2856702 | 370..421 | 260 | 100 | Plus |
2L | 23513712 | 2L | 2856133..2856175 | 1..43 | 215 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 2855809..2855851 | 1..43 | 100 | -> | Plus |
chr2L | 2855923..2855981 | 44..102 | 100 | -> | Plus |
chr2L | 2856053..2856369 | 103..419 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
oho23B-RE | 1..246 | 53..298 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
oho23B-RE | 1..246 | 53..298 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS21-RE | 1..246 | 53..298 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS21-RE | 1..246 | 53..298 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
oho23B-RE | 64..489 | 1..419 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
oho23B-RE | 64..489 | 1..419 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS21-RE | 64..489 | 1..419 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS21-RE | 64..489 | 1..419 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2856377..2856700 | 103..419 | 97 | Plus | |
2L | 2856133..2856175 | 1..43 | 100 | -> | Plus |
2L | 2856247..2856305 | 44..102 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2856377..2856700 | 103..419 | 97 | Plus | |
2L | 2856133..2856175 | 1..43 | 100 | -> | Plus |
2L | 2856247..2856305 | 44..102 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2856377..2856700 | 103..419 | 97 | Plus | |
2L | 2856133..2856175 | 1..43 | 100 | -> | Plus |
2L | 2856247..2856305 | 44..102 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 2856377..2856700 | 103..419 | 97 | Plus | |
arm_2L | 2856133..2856175 | 1..43 | 100 | -> | Plus |
arm_2L | 2856247..2856305 | 44..102 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2856377..2856700 | 103..419 | 97 | Plus | |
2L | 2856133..2856175 | 1..43 | 100 | -> | Plus |
2L | 2856247..2856305 | 44..102 | 100 | -> | Plus |
Translation from 0 to 297
> GM24606.hyp RRVAVARFVNFYKKPNKMENDAGENVDLYVPRKCSASNRIIHAKDHASVQ LSIVDVDPETGRQTDGSKTYAICGEIRRMGESDDCIVRLAKKDGIITK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS21-PE | 81 | CG2986-PE | 1..81 | 18..98 | 420 | 100 | Plus |
RpS21-PD | 83 | CG2986-PD | 1..81 | 18..98 | 420 | 100 | Plus |
RpS21-PB | 83 | CG2986-PB | 1..81 | 18..98 | 420 | 100 | Plus |
RpS21-PA | 83 | CG2986-PA | 1..81 | 18..98 | 420 | 100 | Plus |
RpS21-PF | 83 | CG2986-PF | 1..81 | 18..98 | 420 | 100 | Plus |
Translation from 1 to 297
> GM24606.pep RRVAVARFVNFYKKPNKMENDAGENVDLYVPRKCSASNRIIHAKDHASVQ LSIVDVDPETGRQTDGSKTYAICGEIRRMGESDDCIVRLAKKDGIITK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14986-PA | 83 | GF14986-PA | 1..81 | 18..98 | 422 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24892-PA | 83 | GG24892-PA | 1..81 | 18..98 | 424 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH25136-PA | 81 | GH25136-PA | 1..81 | 18..98 | 411 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS21-PE | 81 | CG2986-PE | 1..81 | 18..98 | 420 | 100 | Plus |
RpS21-PD | 83 | CG2986-PD | 1..81 | 18..98 | 420 | 100 | Plus |
RpS21-PB | 83 | CG2986-PB | 1..81 | 18..98 | 420 | 100 | Plus |
RpS21-PA | 83 | CG2986-PA | 1..81 | 18..98 | 420 | 100 | Plus |
RpS21-PF | 83 | CG2986-PF | 1..81 | 18..98 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19989-PA | 83 | GI19989-PA | 1..81 | 18..98 | 411 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26288-PA | 83 | GL26288-PA | 1..81 | 18..98 | 422 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15559-PA | 83 | GA15559-PA | 1..81 | 18..98 | 422 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18373-PA | 83 | GM18373-PA | 1..81 | 18..98 | 424 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23188-PA | 83 | GD23188-PA | 1..81 | 18..98 | 421 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13417-PA | 81 | GJ13417-PA | 1..81 | 18..98 | 411 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24281-PA | 83 | GK24281-PA | 1..81 | 18..98 | 422 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18186-PA | 83 | GE18186-PA | 1..81 | 18..98 | 424 | 100 | Plus |