Clone GM24606 Report

Search the DGRC for GM24606

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:246
Well:6
Vector:pOT2
Associated Gene/TranscriptRpS21-RE
Protein status:GM24606.pep: gold
Sequenced Size:437

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
oho23B-RE 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

GM24606.complete Sequence

437 bp assembled on 2010-12-02

GenBank Submission: BT125796.1

> GM24606.complete
CCGACGAGTTGCGGTCGCTAGATTTGTAAATTTCTACAAAAAACCCAATA
AAATGGAGAACGACGCCGGTGAGAATGTTGATCTGTACGTGCCCCGCAAA
TGCTCGGCGTCCAACAGGATCATCCACGCCAAGGATCACGCCTCCGTGCA
GCTGAGCATCGTGGATGTGGACCCCGAGACCGGTCGCCAGACCGACGGTT
CCAAGACCTACGCCATCTGCGGCGAGATCCGTCGCATGGGCGAGTCCGAC
GACTGCATCGTGCGTCTGGCCAAGAAGGACGGCATCATTACCAAGTGAGT
TTGTGCTAGAATCCCCGGGATGGACATCCACTAATCGCGCATTTTTCGCC
TTGCAGGAACTTCTAAGTTCCCATAGCTAGATTTTGATTTGGTAATAAAG
CGATTTCCCTTTGTAATTTAAAAAAAAAAAAAAAAAA

GM24606.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2856052..2856369 102..419 1575 99.7 Plus
chr2L 23010047 chr2L 2855923..2855981 44..102 295 100 Plus
chr2L 23010047 chr2L 2855809..2855851 1..43 215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2856376..2856702 102..421 1480 97.6 Plus
2L 23513712 2L 2856247..2856305 44..102 295 100 Plus
2L 23513712 2L 2856133..2856175 1..43 215 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2856376..2856641 102..367 1330 100 Plus
2L 23513712 2L 2856247..2856305 44..102 295 100 Plus
2L 23513712 2L 2856651..2856702 370..421 260 100 Plus
2L 23513712 2L 2856133..2856175 1..43 215 100 Plus
Blast to na_te.dros performed on 2019-03-17 01:12:47 has no hits.

GM24606.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:13:30 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2855809..2855851 1..43 100 -> Plus
chr2L 2855923..2855981 44..102 100 -> Plus
chr2L 2856053..2856369 103..419 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-12-03 14:28:55 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
oho23B-RE 1..246 53..298 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:42:20 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
oho23B-RE 1..246 53..298 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:32:36 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
RpS21-RE 1..246 53..298 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:52:07 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
RpS21-RE 1..246 53..298 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-12-03 14:28:55 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
oho23B-RE 64..489 1..419 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:42:20 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
oho23B-RE 64..489 1..419 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:32:36 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
RpS21-RE 64..489 1..419 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:52:07 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
RpS21-RE 64..489 1..419 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:30 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2856377..2856700 103..419 97   Plus
2L 2856133..2856175 1..43 100 -> Plus
2L 2856247..2856305 44..102 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:30 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2856377..2856700 103..419 97   Plus
2L 2856133..2856175 1..43 100 -> Plus
2L 2856247..2856305 44..102 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:30 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2856377..2856700 103..419 97   Plus
2L 2856133..2856175 1..43 100 -> Plus
2L 2856247..2856305 44..102 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:32:36 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2856377..2856700 103..419 97   Plus
arm_2L 2856133..2856175 1..43 100 -> Plus
arm_2L 2856247..2856305 44..102 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:45:53 Download gff for GM24606.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2856377..2856700 103..419 97   Plus
2L 2856133..2856175 1..43 100 -> Plus
2L 2856247..2856305 44..102 100 -> Plus

GM24606.hyp Sequence

Translation from 0 to 297

> GM24606.hyp
RRVAVARFVNFYKKPNKMENDAGENVDLYVPRKCSASNRIIHAKDHASVQ
LSIVDVDPETGRQTDGSKTYAICGEIRRMGESDDCIVRLAKKDGIITK*

GM24606.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-PE 81 CG2986-PE 1..81 18..98 420 100 Plus
RpS21-PD 83 CG2986-PD 1..81 18..98 420 100 Plus
RpS21-PB 83 CG2986-PB 1..81 18..98 420 100 Plus
RpS21-PA 83 CG2986-PA 1..81 18..98 420 100 Plus
RpS21-PF 83 CG2986-PF 1..81 18..98 420 100 Plus

GM24606.pep Sequence

Translation from 1 to 297

> GM24606.pep
RRVAVARFVNFYKKPNKMENDAGENVDLYVPRKCSASNRIIHAKDHASVQ
LSIVDVDPETGRQTDGSKTYAICGEIRRMGESDDCIVRLAKKDGIITK*

GM24606.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14986-PA 83 GF14986-PA 1..81 18..98 422 98.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24892-PA 83 GG24892-PA 1..81 18..98 424 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25136-PA 81 GH25136-PA 1..81 18..98 411 96.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-PE 81 CG2986-PE 1..81 18..98 420 100 Plus
RpS21-PD 83 CG2986-PD 1..81 18..98 420 100 Plus
RpS21-PB 83 CG2986-PB 1..81 18..98 420 100 Plus
RpS21-PA 83 CG2986-PA 1..81 18..98 420 100 Plus
RpS21-PF 83 CG2986-PF 1..81 18..98 420 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19989-PA 83 GI19989-PA 1..81 18..98 411 96.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26288-PA 83 GL26288-PA 1..81 18..98 422 98.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15559-PA 83 GA15559-PA 1..81 18..98 422 98.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18373-PA 83 GM18373-PA 1..81 18..98 424 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23188-PA 83 GD23188-PA 1..81 18..98 421 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13417-PA 81 GJ13417-PA 1..81 18..98 411 96.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24281-PA 83 GK24281-PA 1..81 18..98 422 98.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18186-PA 83 GE18186-PA 1..81 18..98 424 100 Plus