Clone GM25382 Report

Search the DGRC for GM25382

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:253
Well:82
Vector:pOT2
Associated Gene/TranscriptCG5323-RA
Protein status:GM25382.pep: gold
Preliminary Size:702
Sequenced Size:789

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5323 2002-01-01 Sim4 clustering to Release 2
CG5323 2002-05-18 Blastp of sequenced clone
CG5323 2008-04-29 Release 5.5 accounting
CG5323 2008-08-15 Release 5.9 accounting
CG5323 2008-12-18 5.12 accounting

Clone Sequence Records

GM25382.complete Sequence

789 bp (789 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118866

> GM25382.complete
AAAAACACGCTGCCGGCATTTATTTTGATATTACGAAATCGGTTGTAAGA
CGTAGGTAATTAACAATTAAACAAGCAAAATGATCCAGCAACAGCGCCAG
AAAATCGAGGCCGCGGTAACGGAGATGATCGACGACATGGACAAGACGCA
CCTACGCAAAATGCAGAATGAGATGCACTTGTGTGCGGCCAAGTGCTGCC
AGGATGGAACCTCCAGCGTGGACAGTGTTCAGAGATGTGTGGATCGATGC
TCCGCGCCCATGACGAGGGCACAGAACTACGTTCAACACGAATTGGGCGA
GTTCCAGGGCAGACTTCAACGTTGCGTCATGCAATGCAACGACGATGTGA
AGGTGAAAATGCCGCCCAGTCCCAATGAGGATCAGATAGCCAAGTACACC
GACCAATTCGAGCGCTGTGCCATCCAGTGTGTGGACAAGCATGTGGGCCT
CATTCCCGGCATGATGAAGACCATGAAGGCTGTGCTCTCCAAGGGACCCG
AGAGCATTCCCCAAGTCTAACTCAACCTGCATTTACTACATAATTAGTTG
TTGAATTCGTTTATTTTAAAACCGTGCAATGAGTCCCATCTCTGGAGTCA
TTTCAAATTTTGCTTTTAAGAATATAGAACAAAAATTACCTTATTAATTG
TTGAAAGTCTTAAGCAGCAACCACCAACTGTTGTGCTAACAATCTTCGGA
AGAATGTCAAGTTTTGCCATCAGTAAAAAAAAAAGAAATAAACTTACATA
CTTTGTACACCGAAAACTGTCAAAAAAAAAAAAAAAAAA

GM25382.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG5323-RA 779 CG5323-RA 19..750 1..732 3615 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14502688..14503122 331..771 2080 98.6 Plus
chr2R 21145070 chr2R 14502424..14502591 164..331 840 100 Plus
chr2R 21145070 chr2R 14502201..14502366 1..166 830 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18615569..18615970 331..732 1995 99.8 Plus
2R 25286936 2R 18615305..18615472 164..331 825 99.4 Plus
2R 25286936 2R 18615082..18615247 1..166 815 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18616768..18617169 331..732 1995 99.7 Plus
2R 25260384 2R 18616504..18616671 164..331 825 99.4 Plus
2R 25260384 2R 18616281..18616446 1..166 815 99.3 Plus
2R 25260384 2R 18617173..18617200 746..773 140 100 Plus
Blast to na_te.dros performed 2019-03-16 16:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 1..90 619..532 121 61.1 Minus

GM25382.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:06:55 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14502427..14502591 167..331 100 -> Plus
chr2R 14502201..14502366 1..166 100 -> Plus
chr2R 14502689..14503122 332..771 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:21 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
CG5323-RA 1..441 80..520 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:03:30 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
CG5323-RA 1..441 80..520 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:00:37 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
CG5323-RA 1..441 80..520 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:53:47 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
CG5323-RA 1..441 80..520 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:19:31 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
CG5323-RA 1..441 80..520 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:22:06 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
CG5323-RA 2..762 1..771 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:03:30 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
CG5323-RA 1..761 1..771 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:00:37 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
CG5323-RA 23..783 1..771 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:53:47 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
CG5323-RA 2..762 1..771 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:19:31 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
CG5323-RA 23..783 1..771 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:55 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18615082..18615247 1..166 99 -> Plus
2R 18615308..18615472 167..331 99 -> Plus
2R 18615570..18615999 332..771 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:55 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18615082..18615247 1..166 99 -> Plus
2R 18615308..18615472 167..331 99 -> Plus
2R 18615570..18615999 332..771 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:55 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18615082..18615247 1..166 99 -> Plus
2R 18615308..18615472 167..331 99 -> Plus
2R 18615570..18615999 332..771 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:00:37 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14502587..14502752 1..166 99 -> Plus
arm_2R 14502813..14502977 167..331 99 -> Plus
arm_2R 14503075..14503504 332..771 97   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:25:57 Download gff for GM25382.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18616769..18617198 332..771 97   Plus
2R 18616281..18616446 1..166 99 -> Plus
2R 18616507..18616671 167..331 99 -> Plus

GM25382.hyp Sequence

Translation from 79 to 519

> GM25382.hyp
MIQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSV
QRCVDRCSAPMTRAQNYVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPNE
DQIAKYTDQFERCAIQCVDKHVGLIPGMMKTMKAVLSKGPESIPQV*

GM25382.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG5323-PA 146 CG5323-PA 1..146 1..146 778 100 Plus
CG5327-PA 149 CG5327-PA 1..140 1..140 424 47.1 Plus
CG12661-PB 131 CG12661-PB 8..130 2..139 287 34.8 Plus
CG12661-PA 131 CG12661-PA 8..130 2..139 287 34.8 Plus

GM25382.pep Sequence

Translation from 79 to 519

> GM25382.pep
MIQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSV
QRCVDRCSAPMTRAQNYVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPNE
DQIAKYTDQFERCAIQCVDKHVGLIPGMMKTMKAVLSKGPESIPQV*

GM25382.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11974-PA 146 GF11974-PA 1..146 1..146 737 94.5 Plus
Dana\GF11975-PA 153 GF11975-PA 1..139 1..139 412 46.8 Plus
Dana\GF19183-PA 134 GF19183-PA 8..133 2..139 323 42.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21909-PA 146 GG21909-PA 1..146 1..146 763 97.9 Plus
Dere\GG21910-PA 149 GG21910-PA 1..140 1..140 416 47.1 Plus
Dere\GG19017-PA 131 GG19017-PA 9..130 3..139 240 37.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20300-PA 146 GH20300-PA 1..146 1..146 685 84.2 Plus
Dgri\GH20301-PA 148 GH20301-PA 1..139 1..139 396 45.3 Plus
Dgri\GH25050-PA 148 GH25050-PA 1..139 1..139 396 45.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG5323-PA 146 CG5323-PA 1..146 1..146 778 100 Plus
CG5327-PA 149 CG5327-PA 1..140 1..140 424 47.1 Plus
CG12661-PB 131 CG12661-PB 8..130 2..139 287 34.8 Plus
CG12661-PA 131 CG12661-PA 8..130 2..139 287 34.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19971-PA 154 GI19971-PA 1..139 1..139 403 47.5 Plus
Dmoj\GI19970-PA 60 GI19970-PA 1..43 1..43 174 72.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17027-PA 146 GL17027-PA 1..146 1..146 734 93.8 Plus
Dper\GL17028-PA 153 GL17028-PA 1..140 1..140 416 46.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18804-PA 146 GA18804-PA 1..146 1..146 734 93.8 Plus
Dpse\GA18807-PA 153 GA18807-PA 1..140 1..140 418 46.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21900-PA 146 GM21900-PA 1..146 1..146 769 99.3 Plus
Dsec\GM21901-PA 149 GM21901-PA 1..140 1..140 414 46.4 Plus
Dsec\GM13692-PA 131 GM13692-PA 9..130 3..139 223 35.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11396-PA 146 GD11396-PA 1..146 1..146 769 99.3 Plus
Dsim\GD11397-PA 149 GD11397-PA 1..140 1..140 414 46.4 Plus
Dsim\GD16092-PA 131 GD16092-PA 9..130 3..139 230 36.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21219-PA 146 GJ21219-PA 1..145 1..145 731 92.4 Plus
Dvir\GJ21220-PA 154 GJ21220-PA 1..139 1..139 413 47.5 Plus
Dvir\GJ15392-PA 134 GJ15392-PA 7..133 2..139 317 44.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21964-PA 125 GK21964-PA 1..121 1..121 620 95 Plus
Dwil\GK21965-PA 152 GK21965-PA 1..140 1..140 417 47.9 Plus
Dwil\GK16197-PA 136 GK16197-PA 7..135 2..139 337 44.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11983-PA 146 GE11983-PA 1..146 1..146 755 96.6 Plus
Dyak\GE11984-PA 149 GE11984-PA 1..140 1..140 414 46.4 Plus
Dyak\GE17426-PA 132 GE17426-PA 10..131 3..139 229 38 Plus