BDGP Sequence Production Resources |
Search the DGRC for GM25382
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 253 |
Well: | 82 |
Vector: | pOT2 |
Associated Gene/Transcript | CG5323-RA |
Protein status: | GM25382.pep: gold |
Preliminary Size: | 702 |
Sequenced Size: | 789 |
Gene | Date | Evidence |
---|---|---|
CG5323 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5323 | 2002-05-18 | Blastp of sequenced clone |
CG5323 | 2008-04-29 | Release 5.5 accounting |
CG5323 | 2008-08-15 | Release 5.9 accounting |
CG5323 | 2008-12-18 | 5.12 accounting |
789 bp (789 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118866
> GM25382.complete AAAAACACGCTGCCGGCATTTATTTTGATATTACGAAATCGGTTGTAAGA CGTAGGTAATTAACAATTAAACAAGCAAAATGATCCAGCAACAGCGCCAG AAAATCGAGGCCGCGGTAACGGAGATGATCGACGACATGGACAAGACGCA CCTACGCAAAATGCAGAATGAGATGCACTTGTGTGCGGCCAAGTGCTGCC AGGATGGAACCTCCAGCGTGGACAGTGTTCAGAGATGTGTGGATCGATGC TCCGCGCCCATGACGAGGGCACAGAACTACGTTCAACACGAATTGGGCGA GTTCCAGGGCAGACTTCAACGTTGCGTCATGCAATGCAACGACGATGTGA AGGTGAAAATGCCGCCCAGTCCCAATGAGGATCAGATAGCCAAGTACACC GACCAATTCGAGCGCTGTGCCATCCAGTGTGTGGACAAGCATGTGGGCCT CATTCCCGGCATGATGAAGACCATGAAGGCTGTGCTCTCCAAGGGACCCG AGAGCATTCCCCAAGTCTAACTCAACCTGCATTTACTACATAATTAGTTG TTGAATTCGTTTATTTTAAAACCGTGCAATGAGTCCCATCTCTGGAGTCA TTTCAAATTTTGCTTTTAAGAATATAGAACAAAAATTACCTTATTAATTG TTGAAAGTCTTAAGCAGCAACCACCAACTGTTGTGCTAACAATCTTCGGA AGAATGTCAAGTTTTGCCATCAGTAAAAAAAAAAGAAATAAACTTACATA CTTTGTACACCGAAAACTGTCAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5323-RA | 779 | CG5323-RA | 19..750 | 1..732 | 3615 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 14502688..14503122 | 331..771 | 2080 | 98.6 | Plus |
chr2R | 21145070 | chr2R | 14502424..14502591 | 164..331 | 840 | 100 | Plus |
chr2R | 21145070 | chr2R | 14502201..14502366 | 1..166 | 830 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 18615569..18615970 | 331..732 | 1995 | 99.8 | Plus |
2R | 25286936 | 2R | 18615305..18615472 | 164..331 | 825 | 99.4 | Plus |
2R | 25286936 | 2R | 18615082..18615247 | 1..166 | 815 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 18616768..18617169 | 331..732 | 1995 | 99.7 | Plus |
2R | 25260384 | 2R | 18616504..18616671 | 164..331 | 825 | 99.4 | Plus |
2R | 25260384 | 2R | 18616281..18616446 | 1..166 | 815 | 99.3 | Plus |
2R | 25260384 | 2R | 18617173..18617200 | 746..773 | 140 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
TAHRE | 10463 | TAHRE OSV 10463bp | 1..90 | 619..532 | 121 | 61.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 14502427..14502591 | 167..331 | 100 | -> | Plus |
chr2R | 14502201..14502366 | 1..166 | 100 | -> | Plus |
chr2R | 14502689..14503122 | 332..771 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5323-RA | 1..441 | 80..520 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5323-RA | 1..441 | 80..520 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5323-RA | 1..441 | 80..520 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5323-RA | 1..441 | 80..520 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5323-RA | 1..441 | 80..520 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5323-RA | 2..762 | 1..771 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5323-RA | 1..761 | 1..771 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5323-RA | 23..783 | 1..771 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5323-RA | 2..762 | 1..771 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5323-RA | 23..783 | 1..771 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18615082..18615247 | 1..166 | 99 | -> | Plus |
2R | 18615308..18615472 | 167..331 | 99 | -> | Plus |
2R | 18615570..18615999 | 332..771 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18615082..18615247 | 1..166 | 99 | -> | Plus |
2R | 18615308..18615472 | 167..331 | 99 | -> | Plus |
2R | 18615570..18615999 | 332..771 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18615082..18615247 | 1..166 | 99 | -> | Plus |
2R | 18615308..18615472 | 167..331 | 99 | -> | Plus |
2R | 18615570..18615999 | 332..771 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 14502587..14502752 | 1..166 | 99 | -> | Plus |
arm_2R | 14502813..14502977 | 167..331 | 99 | -> | Plus |
arm_2R | 14503075..14503504 | 332..771 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18616769..18617198 | 332..771 | 97 | Plus | |
2R | 18616281..18616446 | 1..166 | 99 | -> | Plus |
2R | 18616507..18616671 | 167..331 | 99 | -> | Plus |
Translation from 79 to 519
> GM25382.hyp MIQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSV QRCVDRCSAPMTRAQNYVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPNE DQIAKYTDQFERCAIQCVDKHVGLIPGMMKTMKAVLSKGPESIPQV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5323-PA | 146 | CG5323-PA | 1..146 | 1..146 | 778 | 100 | Plus |
CG5327-PA | 149 | CG5327-PA | 1..140 | 1..140 | 424 | 47.1 | Plus |
CG12661-PB | 131 | CG12661-PB | 8..130 | 2..139 | 287 | 34.8 | Plus |
CG12661-PA | 131 | CG12661-PA | 8..130 | 2..139 | 287 | 34.8 | Plus |
Translation from 79 to 519
> GM25382.pep MIQQQRQKIEAAVTEMIDDMDKTHLRKMQNEMHLCAAKCCQDGTSSVDSV QRCVDRCSAPMTRAQNYVQHELGEFQGRLQRCVMQCNDDVKVKMPPSPNE DQIAKYTDQFERCAIQCVDKHVGLIPGMMKTMKAVLSKGPESIPQV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11974-PA | 146 | GF11974-PA | 1..146 | 1..146 | 737 | 94.5 | Plus |
Dana\GF11975-PA | 153 | GF11975-PA | 1..139 | 1..139 | 412 | 46.8 | Plus |
Dana\GF19183-PA | 134 | GF19183-PA | 8..133 | 2..139 | 323 | 42.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21909-PA | 146 | GG21909-PA | 1..146 | 1..146 | 763 | 97.9 | Plus |
Dere\GG21910-PA | 149 | GG21910-PA | 1..140 | 1..140 | 416 | 47.1 | Plus |
Dere\GG19017-PA | 131 | GG19017-PA | 9..130 | 3..139 | 240 | 37.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20300-PA | 146 | GH20300-PA | 1..146 | 1..146 | 685 | 84.2 | Plus |
Dgri\GH20301-PA | 148 | GH20301-PA | 1..139 | 1..139 | 396 | 45.3 | Plus |
Dgri\GH25050-PA | 148 | GH25050-PA | 1..139 | 1..139 | 396 | 45.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5323-PA | 146 | CG5323-PA | 1..146 | 1..146 | 778 | 100 | Plus |
CG5327-PA | 149 | CG5327-PA | 1..140 | 1..140 | 424 | 47.1 | Plus |
CG12661-PB | 131 | CG12661-PB | 8..130 | 2..139 | 287 | 34.8 | Plus |
CG12661-PA | 131 | CG12661-PA | 8..130 | 2..139 | 287 | 34.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19971-PA | 154 | GI19971-PA | 1..139 | 1..139 | 403 | 47.5 | Plus |
Dmoj\GI19970-PA | 60 | GI19970-PA | 1..43 | 1..43 | 174 | 72.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17027-PA | 146 | GL17027-PA | 1..146 | 1..146 | 734 | 93.8 | Plus |
Dper\GL17028-PA | 153 | GL17028-PA | 1..140 | 1..140 | 416 | 46.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18804-PA | 146 | GA18804-PA | 1..146 | 1..146 | 734 | 93.8 | Plus |
Dpse\GA18807-PA | 153 | GA18807-PA | 1..140 | 1..140 | 418 | 46.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21900-PA | 146 | GM21900-PA | 1..146 | 1..146 | 769 | 99.3 | Plus |
Dsec\GM21901-PA | 149 | GM21901-PA | 1..140 | 1..140 | 414 | 46.4 | Plus |
Dsec\GM13692-PA | 131 | GM13692-PA | 9..130 | 3..139 | 223 | 35.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11396-PA | 146 | GD11396-PA | 1..146 | 1..146 | 769 | 99.3 | Plus |
Dsim\GD11397-PA | 149 | GD11397-PA | 1..140 | 1..140 | 414 | 46.4 | Plus |
Dsim\GD16092-PA | 131 | GD16092-PA | 9..130 | 3..139 | 230 | 36.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21219-PA | 146 | GJ21219-PA | 1..145 | 1..145 | 731 | 92.4 | Plus |
Dvir\GJ21220-PA | 154 | GJ21220-PA | 1..139 | 1..139 | 413 | 47.5 | Plus |
Dvir\GJ15392-PA | 134 | GJ15392-PA | 7..133 | 2..139 | 317 | 44.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21964-PA | 125 | GK21964-PA | 1..121 | 1..121 | 620 | 95 | Plus |
Dwil\GK21965-PA | 152 | GK21965-PA | 1..140 | 1..140 | 417 | 47.9 | Plus |
Dwil\GK16197-PA | 136 | GK16197-PA | 7..135 | 2..139 | 337 | 44.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11983-PA | 146 | GE11983-PA | 1..146 | 1..146 | 755 | 96.6 | Plus |
Dyak\GE11984-PA | 149 | GE11984-PA | 1..140 | 1..140 | 414 | 46.4 | Plus |
Dyak\GE17426-PA | 132 | GE17426-PA | 10..131 | 3..139 | 229 | 38 | Plus |