Clone GM25447 Report

Search the DGRC for GM25447

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:254
Well:47
Vector:pOT2
Associated Gene/TranscriptmRpS10-RB
Protein status:GM25447.pep: gold
Sequenced Size:720

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4247 2002-11-11 Blastp of sequenced clone
mRpS10 2008-04-29 Release 5.5 accounting
mRpS10 2008-08-15 Release 5.9 accounting
CG34316 2008-08-15 Release 5.9 accounting
mRpS10 2008-12-18 5.12 accounting
CG34316 2008-12-18 5.12 accounting

Clone Sequence Records

GM25447.complete Sequence

720 bp (720 high quality bases) assembled on 2002-11-11

GenBank Submission: BT001464

> GM25447.complete
ATTCGGCACGAGTATCAATGAAAATGCATATGAAACATCTAGATTTATAT
TCCCAGGCTATAAAGACGCTCCGCTGGACACAGCCAATGCGGGCTCTGTC
CACGGTAAACACCAGTTCCGGCGTACAAGGCAATCTTTCACCTGCGGCAC
CTGCTCCGGAACCGGATAAACTCTACAGCAAGCTGGAGATTGAGCTGCGG
GGTATTGATCCGGCAGTTCTGAAGAGCTACACCTGGTTTGCTACTACTGC
TGCCGAGCATTTGGGCATTGAAAAGGGAAAATGTTGGTCACCTCGCAAGG
CGCACCACGAGCGGATGACGCTCCTGAAGTCGGTGCATATCTACAAGAAA
CATCGCGTACAGTACGAGGTGCGAACCCACTTCCGCTATATGAACTTCCA
CAAGTTGACGGGCTCCACGCTAGATACATTTCTAGAGTATATTGAACGTA
ATCTGCCCGAGGGCGTAGCGCTGCAGGCTTCCAGGACTGAGCTGCAGGAG
ATCCCAGAGCACTTGCGCCAGCCGCCGGAGCAAGTTTAGCCGAAGCCAAT
ACTACAGTAGACCTTAGTTATTAAAAGTTCAGTATGAGCTTAGATTGCAC
CAGCAATCCGCACGGTAATCGGCCGTACTCGGGCCCCGTCCGCGATTAGC
AAAGATAAGTTTTTGGCAGAATATTGAAATAAAAGTCGTATCTTGACACA
AAAAAAAAAAAAAAAAAAAA

GM25447.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:34:21
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS10-RB 746 mRpS10-RB 56..743 13..700 3440 100 Plus
mRpS10-RD 746 mRpS10-RD 84..743 41..700 3300 100 Plus
mRpS10-RA 732 mRpS10-RA 83..729 54..700 3235 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11054726..11055142 283..699 2085 100 Plus
chr3R 27901430 chr3R 11054387..11054657 13..283 1355 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15230096..15230513 283..700 2090 100 Plus
3R 32079331 3R 15229757..15230027 13..283 1355 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14970927..14971344 283..700 2090 100 Plus
3R 31820162 3R 14970588..14970858 13..283 1355 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:03:46 has no hits.

GM25447.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:04:51 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11054383..11054657 7..283 98 -> Plus
chr3R 11054727..11055142 284..699 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:23 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RB 1..522 18..539 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:05:38 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RB 1..522 18..539 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:55:02 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RB 1..522 18..539 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:37 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RB 1..522 18..539 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:53:30 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RB 1..522 18..539 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:25:05 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RB 2..691 11..699 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:05:38 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RB 52..742 7..699 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:55:02 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RB 52..742 7..699 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:38 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RB 2..691 11..699 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:53:30 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS10-RB 52..742 7..699 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:04:51 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15229753..15230027 7..283 98 -> Plus
3R 15230097..15230512 284..699 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:04:51 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15229753..15230027 7..283 98 -> Plus
3R 15230097..15230512 284..699 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:04:51 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15229753..15230027 7..283 98 -> Plus
3R 15230097..15230512 284..699 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:55:02 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11055475..11055749 7..283 98 -> Plus
arm_3R 11055819..11056234 284..699 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:28:00 Download gff for GM25447.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14970584..14970858 7..283 98 -> Plus
3R 14970928..14971343 284..699 100   Plus

GM25447.hyp Sequence

Translation from 7 to 538

> GM25447.hyp
HISMKMHMKHLDLYSQAIKTLRWTQPMRALSTVNTSSGVQGNLSPAAPAP
EPDKLYSKLEIELRGIDPAVLKSYTWFATTAAEHLGIEKGKCWSPRKAHH
ERMTLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTGSTLDTFLEYIERNLP
EGVALQASRTELQEIPEHLRQPPEQV*

GM25447.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS10-PB 173 CG4247-PB 1..173 4..176 915 100 Plus
mRpS10-PA 163 CG4247-PA 3..163 16..176 849 100 Plus

GM25447.pep Sequence

Translation from 17 to 538

> GM25447.pep
MKMHMKHLDLYSQAIKTLRWTQPMRALSTVNTSSGVQGNLSPAAPAPEPD
KLYSKLEIELRGIDPAVLKSYTWFATTAAEHLGIEKGKCWSPRKAHHERM
TLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTGSTLDTFLEYIERNLPEGV
ALQASRTELQEIPEHLRQPPEQV*

GM25447.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24771-PA 164 GF24771-PA 3..164 13..173 744 85.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16898-PA 163 GG16898-PA 3..163 13..173 814 93.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18846-PA 160 GH18846-PA 3..160 13..173 695 82 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS10-PB 173 CG4247-PB 1..173 1..173 915 100 Plus
mRpS10-PA 163 CG4247-PA 3..163 13..173 849 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22917-PA 166 GI22917-PA 3..166 13..173 684 79.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12532-PA 162 GL12532-PA 3..162 13..173 746 85.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18057-PA 162 GA18057-PA 3..162 13..173 741 84.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24206-PA 163 GM24206-PA 3..163 13..173 850 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18996-PA 163 GD18996-PA 3..163 13..173 849 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23200-PA 166 GJ23200-PA 3..166 13..173 698 82.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14488-PA 157 GK14488-PA 3..157 13..173 662 78.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24280-PA 163 GE24280-PA 3..163 13..173 816 93.8 Plus