BDGP Sequence Production Resources |
Search the DGRC for GM25447
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 254 |
Well: | 47 |
Vector: | pOT2 |
Associated Gene/Transcript | mRpS10-RB |
Protein status: | GM25447.pep: gold |
Sequenced Size: | 720 |
Gene | Date | Evidence |
---|---|---|
CG4247 | 2002-11-11 | Blastp of sequenced clone |
mRpS10 | 2008-04-29 | Release 5.5 accounting |
mRpS10 | 2008-08-15 | Release 5.9 accounting |
CG34316 | 2008-08-15 | Release 5.9 accounting |
mRpS10 | 2008-12-18 | 5.12 accounting |
CG34316 | 2008-12-18 | 5.12 accounting |
720 bp (720 high quality bases) assembled on 2002-11-11
GenBank Submission: BT001464
> GM25447.complete ATTCGGCACGAGTATCAATGAAAATGCATATGAAACATCTAGATTTATAT TCCCAGGCTATAAAGACGCTCCGCTGGACACAGCCAATGCGGGCTCTGTC CACGGTAAACACCAGTTCCGGCGTACAAGGCAATCTTTCACCTGCGGCAC CTGCTCCGGAACCGGATAAACTCTACAGCAAGCTGGAGATTGAGCTGCGG GGTATTGATCCGGCAGTTCTGAAGAGCTACACCTGGTTTGCTACTACTGC TGCCGAGCATTTGGGCATTGAAAAGGGAAAATGTTGGTCACCTCGCAAGG CGCACCACGAGCGGATGACGCTCCTGAAGTCGGTGCATATCTACAAGAAA CATCGCGTACAGTACGAGGTGCGAACCCACTTCCGCTATATGAACTTCCA CAAGTTGACGGGCTCCACGCTAGATACATTTCTAGAGTATATTGAACGTA ATCTGCCCGAGGGCGTAGCGCTGCAGGCTTCCAGGACTGAGCTGCAGGAG ATCCCAGAGCACTTGCGCCAGCCGCCGGAGCAAGTTTAGCCGAAGCCAAT ACTACAGTAGACCTTAGTTATTAAAAGTTCAGTATGAGCTTAGATTGCAC CAGCAATCCGCACGGTAATCGGCCGTACTCGGGCCCCGTCCGCGATTAGC AAAGATAAGTTTTTGGCAGAATATTGAAATAAAAGTCGTATCTTGACACA AAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 11054383..11054657 | 7..283 | 98 | -> | Plus |
chr3R | 11054727..11055142 | 284..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RB | 1..522 | 18..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RB | 1..522 | 18..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RB | 1..522 | 18..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RB | 1..522 | 18..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RB | 1..522 | 18..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RB | 2..691 | 11..699 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RB | 52..742 | 7..699 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RB | 52..742 | 7..699 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RB | 2..691 | 11..699 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS10-RB | 52..742 | 7..699 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15229753..15230027 | 7..283 | 98 | -> | Plus |
3R | 15230097..15230512 | 284..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15229753..15230027 | 7..283 | 98 | -> | Plus |
3R | 15230097..15230512 | 284..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15229753..15230027 | 7..283 | 98 | -> | Plus |
3R | 15230097..15230512 | 284..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 11055475..11055749 | 7..283 | 98 | -> | Plus |
arm_3R | 11055819..11056234 | 284..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 14970584..14970858 | 7..283 | 98 | -> | Plus |
3R | 14970928..14971343 | 284..699 | 100 | Plus |
Translation from 7 to 538
> GM25447.hyp HISMKMHMKHLDLYSQAIKTLRWTQPMRALSTVNTSSGVQGNLSPAAPAP EPDKLYSKLEIELRGIDPAVLKSYTWFATTAAEHLGIEKGKCWSPRKAHH ERMTLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTGSTLDTFLEYIERNLP EGVALQASRTELQEIPEHLRQPPEQV*
Translation from 17 to 538
> GM25447.pep MKMHMKHLDLYSQAIKTLRWTQPMRALSTVNTSSGVQGNLSPAAPAPEPD KLYSKLEIELRGIDPAVLKSYTWFATTAAEHLGIEKGKCWSPRKAHHERM TLLKSVHIYKKHRVQYEVRTHFRYMNFHKLTGSTLDTFLEYIERNLPEGV ALQASRTELQEIPEHLRQPPEQV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24771-PA | 164 | GF24771-PA | 3..164 | 13..173 | 744 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16898-PA | 163 | GG16898-PA | 3..163 | 13..173 | 814 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18846-PA | 160 | GH18846-PA | 3..160 | 13..173 | 695 | 82 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS10-PB | 173 | CG4247-PB | 1..173 | 1..173 | 915 | 100 | Plus |
mRpS10-PA | 163 | CG4247-PA | 3..163 | 13..173 | 849 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22917-PA | 166 | GI22917-PA | 3..166 | 13..173 | 684 | 79.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12532-PA | 162 | GL12532-PA | 3..162 | 13..173 | 746 | 85.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18057-PA | 162 | GA18057-PA | 3..162 | 13..173 | 741 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24206-PA | 163 | GM24206-PA | 3..163 | 13..173 | 850 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18996-PA | 163 | GD18996-PA | 3..163 | 13..173 | 849 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23200-PA | 166 | GJ23200-PA | 3..166 | 13..173 | 698 | 82.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14488-PA | 157 | GK14488-PA | 3..157 | 13..173 | 662 | 78.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24280-PA | 163 | GE24280-PA | 3..163 | 13..173 | 816 | 93.8 | Plus |