BDGP Sequence Production Resources |
Search the DGRC for GM26647
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 266 |
Well: | 47 |
Vector: | pOT2 |
Associated Gene/Transcript | RpS19a-RA |
Protein status: | GM26647.pep: gold |
Preliminary Size: | 584 |
Sequenced Size: | 673 |
Gene | Date | Evidence |
---|---|---|
CG4464 | 2002-01-01 | Sim4 clustering to Release 2 |
CG4464 | 2002-05-18 | Blastp of sequenced clone |
CG4464 | 2003-01-01 | Sim4 clustering to Release 3 |
RpS19a | 2008-04-29 | Release 5.5 accounting |
RpS19a | 2008-08-15 | Release 5.9 accounting |
RpS19a | 2008-12-18 | 5.12 accounting |
673 bp (673 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118868
> GM26647.complete CCAACTTCACGCGCCTTGTTCTTTTTTCCGGTTGACTTTAACGAGAAAGA TGCCAGGCGTCACAGTGAAGGATATTGACCAGCACGCGGTTACCAAGGCG GTCGCCGTCTTCTTGAAGAAGACTGGCAAGTTGAAGGTGCCCGACCAGAT GGACATCGTCAAGACCGCCAAATTCAAGGAGCTGGCGCCCTACGATCCCG ACTGGTTCTATGTGCGTTGCGCCTCGATCCTGCGCCATCTGTACCACCGC AGTCCCGCTGGAGTCGGTTCGATCACCAAGATCTACGGCGGACGCAAGCG CAACGGTGTCCACCCCTCGCACTTCTGCCGCGCCGCCGACGGTGCTGCCC GCAAGGCTCTGCAGGCCTTGGAGCACGCCCGTTTGGTCGAGAAGCACCCG GACGGTGGTCGCAAACTGAGCTCCATTGGACAGCGTGATCTGGACCGTAT TGCTAACCAGATCGTGTTCAAGCAGCGCGATGCCGCCAAGCAGACCGGGC CCATTGTTATTTCCAAGTAATCACACGGCGCCCCTTCGAATTCTAAAAAA CGCATTTTTAGACTTCTATTGTAAGCGCTTTTTGTTTGCACGAGAGAGAT GAGAAAATAAAACCAACCACAATTTGTAAAAGTCTAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS19a.b | 1217 | RpS19a.b | 119..754 | 1..636 | 3180 | 100 | Plus |
RpS19a-RA | 1154 | RpS19a-RA | 119..754 | 1..636 | 3180 | 100 | Plus |
RpS19a-RC | 1419 | RpS19a-RC | 368..956 | 48..636 | 2945 | 100 | Plus |
RpS19a-RC | 1419 | RpS19a-RC | 16..64 | 1..49 | 245 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 16528074..16528588 | 121..635 | 2575 | 100 | Plus |
chrX | 22417052 | chrX | 16527899..16527972 | 48..121 | 370 | 100 | Plus |
chrX | 22417052 | chrX | 16527547..16527595 | 1..49 | 245 | 100 | Plus |
chr3R | 27901430 | chr3R | 19756565..19756675 | 309..199 | 195 | 78.4 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 16638406..16638921 | 121..636 | 2580 | 100 | Plus |
X | 23542271 | X | 16638231..16638304 | 48..121 | 370 | 100 | Plus |
X | 23542271 | X | 16637879..16637927 | 1..49 | 245 | 100 | Plus |
3R | 32079331 | 3R | 23933136..23933246 | 309..199 | 195 | 78.4 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 16646504..16647019 | 121..636 | 2580 | 100 | Plus |
X | 23527363 | X | 16646329..16646402 | 48..121 | 370 | 100 | Plus |
X | 23527363 | X | 16645977..16646025 | 1..49 | 245 | 100 | Plus |
3R | 31820162 | 3R | 23673967..23674077 | 309..199 | 195 | 78.3 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 16527547..16527595 | 1..49 | 100 | -> | Plus |
chrX | 16527901..16527971 | 50..120 | 100 | -> | Plus |
chrX | 16528074..16528588 | 121..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19a-RA | 1..471 | 50..520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19a-RA | 1..471 | 50..520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19a-RB | 1..471 | 50..520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19a-RA | 1..471 | 50..520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19a-RC | 1..471 | 50..520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19a-RA | 1..635 | 1..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19a-RA | 1..635 | 1..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19a-RD | 1..620 | 16..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19a-RA | 1..635 | 1..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS19a-RD | 1..620 | 16..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 16637879..16637927 | 1..49 | 100 | -> | Plus |
X | 16638233..16638303 | 50..120 | 100 | -> | Plus |
X | 16638406..16638920 | 121..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 16637879..16637927 | 1..49 | 100 | -> | Plus |
X | 16638233..16638303 | 50..120 | 100 | -> | Plus |
X | 16638406..16638920 | 121..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 16637879..16637927 | 1..49 | 100 | -> | Plus |
X | 16638233..16638303 | 50..120 | 100 | -> | Plus |
X | 16638406..16638920 | 121..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 16531912..16531960 | 1..49 | 100 | -> | Plus |
arm_X | 16532266..16532336 | 50..120 | 100 | -> | Plus |
arm_X | 16532439..16532953 | 121..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 16646504..16647018 | 121..635 | 100 | Plus | |
X | 16645977..16646025 | 1..49 | 100 | -> | Plus |
X | 16646331..16646401 | 50..120 | 100 | -> | Plus |
Translation from 0 to 519
> GM26647.hyp QLHAPCSFFRLTLTRKMPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQM DIVKTAKFKELAPYDPDWFYVRCASILRHLYHRSPAGVGSITKIYGGRKR NGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQRDLDRI ANQIVFKQRDAAKQTGPIVISK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS19a-PE | 156 | CG4464-PE | 1..156 | 17..172 | 812 | 100 | Plus |
RpS19a-PA | 156 | CG4464-PA | 1..156 | 17..172 | 812 | 100 | Plus |
RpS19a-PC | 156 | CG4464-PC | 1..156 | 17..172 | 812 | 100 | Plus |
RpS19a-PB | 156 | CG4464-PB | 1..156 | 17..172 | 812 | 100 | Plus |
RpS19a-PD | 156 | CG4464-PD | 1..156 | 17..172 | 812 | 100 | Plus |
Translation from 49 to 519
> GM26647.pep MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDP DWFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAA RKALQALEHARLVEKHPDGGRKLSSIGQRDLDRIANQIVFKQRDAAKQTG PIVISK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21022-PA | 156 | GF21022-PA | 1..156 | 1..156 | 801 | 97.4 | Plus |
Dana\GF17022-PA | 156 | GF17022-PA | 1..155 | 1..155 | 595 | 67.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19061-PA | 156 | GG19061-PA | 1..156 | 1..156 | 817 | 99.4 | Plus |
Dere\GG12389-PA | 155 | GG12389-PA | 1..154 | 1..155 | 578 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12611-PA | 156 | GH12611-PA | 1..156 | 1..156 | 809 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS19a-PE | 156 | CG4464-PE | 1..156 | 1..156 | 812 | 100 | Plus |
RpS19a-PA | 156 | CG4464-PA | 1..156 | 1..156 | 812 | 100 | Plus |
RpS19a-PC | 156 | CG4464-PC | 1..156 | 1..156 | 812 | 100 | Plus |
RpS19a-PB | 156 | CG4464-PB | 1..156 | 1..156 | 812 | 100 | Plus |
RpS19a-PD | 156 | CG4464-PD | 1..156 | 1..156 | 812 | 100 | Plus |
RpS19b-PC | 155 | CG5338-PC | 1..153 | 1..153 | 541 | 66.7 | Plus |
RpS19b-PB | 155 | CG5338-PB | 1..153 | 1..153 | 541 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11025-PA | 156 | GI11025-PA | 1..156 | 1..156 | 805 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL27068-PA | 156 | GL27068-PA | 1..156 | 1..156 | 806 | 97.4 | Plus |
Dper\GL18204-PA | 156 | GL18204-PA | 1..156 | 1..156 | 806 | 97.4 | Plus |
Dper\GL13146-PA | 151 | GL13146-PA | 1..151 | 1..156 | 694 | 87.2 | Plus |
Dper\GL24165-PA | 163 | GL24165-PA | 1..151 | 1..153 | 540 | 62.1 | Plus |
Dper\GL15432-PA | 104 | GL15432-PA | 1..88 | 28..151 | 224 | 45.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA27710-PA | 156 | GA27710-PA | 1..156 | 1..156 | 806 | 97.4 | Plus |
Dpse\GA18203-PA | 156 | GA18203-PA | 1..156 | 1..156 | 806 | 97.4 | Plus |
Dpse\GA23235-PA | 156 | GA23235-PA | 1..156 | 1..156 | 781 | 94.2 | Plus |
Dpse\GA18813-PA | 163 | GA18813-PA | 1..151 | 1..153 | 549 | 62.7 | Plus |
Dpse\GA25986-PA | 191 | GA25986-PA | 37..155 | 10..136 | 451 | 74 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13451-PA | 134 | GM13451-PA | 1..134 | 23..156 | 705 | 99.3 | Plus |
Dsec\GM23526-PA | 155 | GM23526-PA | 1..154 | 1..155 | 541 | 64.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17290-PA | 169 | GD17290-PA | 1..156 | 1..156 | 816 | 99.4 | Plus |
Dsim\GD18336-PA | 155 | GD18336-PA | 1..154 | 1..155 | 541 | 64.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15624-PA | 156 | GJ15624-PA | 1..156 | 1..156 | 806 | 98.1 | Plus |