Clone GM26647 Report

Search the DGRC for GM26647

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:266
Well:47
Vector:pOT2
Associated Gene/TranscriptRpS19a-RA
Protein status:GM26647.pep: gold
Preliminary Size:584
Sequenced Size:673

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4464 2002-01-01 Sim4 clustering to Release 2
CG4464 2002-05-18 Blastp of sequenced clone
CG4464 2003-01-01 Sim4 clustering to Release 3
RpS19a 2008-04-29 Release 5.5 accounting
RpS19a 2008-08-15 Release 5.9 accounting
RpS19a 2008-12-18 5.12 accounting

Clone Sequence Records

GM26647.complete Sequence

673 bp (673 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118868

> GM26647.complete
CCAACTTCACGCGCCTTGTTCTTTTTTCCGGTTGACTTTAACGAGAAAGA
TGCCAGGCGTCACAGTGAAGGATATTGACCAGCACGCGGTTACCAAGGCG
GTCGCCGTCTTCTTGAAGAAGACTGGCAAGTTGAAGGTGCCCGACCAGAT
GGACATCGTCAAGACCGCCAAATTCAAGGAGCTGGCGCCCTACGATCCCG
ACTGGTTCTATGTGCGTTGCGCCTCGATCCTGCGCCATCTGTACCACCGC
AGTCCCGCTGGAGTCGGTTCGATCACCAAGATCTACGGCGGACGCAAGCG
CAACGGTGTCCACCCCTCGCACTTCTGCCGCGCCGCCGACGGTGCTGCCC
GCAAGGCTCTGCAGGCCTTGGAGCACGCCCGTTTGGTCGAGAAGCACCCG
GACGGTGGTCGCAAACTGAGCTCCATTGGACAGCGTGATCTGGACCGTAT
TGCTAACCAGATCGTGTTCAAGCAGCGCGATGCCGCCAAGCAGACCGGGC
CCATTGTTATTTCCAAGTAATCACACGGCGCCCCTTCGAATTCTAAAAAA
CGCATTTTTAGACTTCTATTGTAAGCGCTTTTTGTTTGCACGAGAGAGAT
GAGAAAATAAAACCAACCACAATTTGTAAAAGTCTAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

GM26647.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
RpS19a.b 1217 RpS19a.b 119..754 1..636 3180 100 Plus
RpS19a-RA 1154 RpS19a-RA 119..754 1..636 3180 100 Plus
RpS19a-RC 1419 RpS19a-RC 368..956 48..636 2945 100 Plus
RpS19a-RC 1419 RpS19a-RC 16..64 1..49 245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16528074..16528588 121..635 2575 100 Plus
chrX 22417052 chrX 16527899..16527972 48..121 370 100 Plus
chrX 22417052 chrX 16527547..16527595 1..49 245 100 Plus
chr3R 27901430 chr3R 19756565..19756675 309..199 195 78.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:25:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16638406..16638921 121..636 2580 100 Plus
X 23542271 X 16638231..16638304 48..121 370 100 Plus
X 23542271 X 16637879..16637927 1..49 245 100 Plus
3R 32079331 3R 23933136..23933246 309..199 195 78.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16646504..16647019 121..636 2580 100 Plus
X 23527363 X 16646329..16646402 48..121 370 100 Plus
X 23527363 X 16645977..16646025 1..49 245 100 Plus
3R 31820162 3R 23673967..23674077 309..199 195 78.3 Minus
Blast to na_te.dros performed on 2019-03-15 12:32:05 has no hits.

GM26647.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:33:02 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16527547..16527595 1..49 100 -> Plus
chrX 16527901..16527971 50..120 100 -> Plus
chrX 16528074..16528588 121..635 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:26 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19a-RA 1..471 50..520 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:33 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19a-RA 1..471 50..520 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:44:49 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19a-RB 1..471 50..520 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:58 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19a-RA 1..471 50..520 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:02:31 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19a-RC 1..471 50..520 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:25 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19a-RA 1..635 1..635 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:33 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19a-RA 1..635 1..635 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:44:49 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19a-RD 1..620 16..635 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:58 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19a-RA 1..635 1..635 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:02:31 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
RpS19a-RD 1..620 16..635 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:33:02 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
X 16637879..16637927 1..49 100 -> Plus
X 16638233..16638303 50..120 100 -> Plus
X 16638406..16638920 121..635 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:33:02 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
X 16637879..16637927 1..49 100 -> Plus
X 16638233..16638303 50..120 100 -> Plus
X 16638406..16638920 121..635 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:33:02 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
X 16637879..16637927 1..49 100 -> Plus
X 16638233..16638303 50..120 100 -> Plus
X 16638406..16638920 121..635 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:44:49 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16531912..16531960 1..49 100 -> Plus
arm_X 16532266..16532336 50..120 100 -> Plus
arm_X 16532439..16532953 121..635 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:59 Download gff for GM26647.complete
Subject Subject Range Query Range Percent Splice Strand
X 16646504..16647018 121..635 100   Plus
X 16645977..16646025 1..49 100 -> Plus
X 16646331..16646401 50..120 100 -> Plus

GM26647.hyp Sequence

Translation from 0 to 519

> GM26647.hyp
QLHAPCSFFRLTLTRKMPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQM
DIVKTAKFKELAPYDPDWFYVRCASILRHLYHRSPAGVGSITKIYGGRKR
NGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQRDLDRI
ANQIVFKQRDAAKQTGPIVISK*

GM26647.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
RpS19a-PE 156 CG4464-PE 1..156 17..172 812 100 Plus
RpS19a-PA 156 CG4464-PA 1..156 17..172 812 100 Plus
RpS19a-PC 156 CG4464-PC 1..156 17..172 812 100 Plus
RpS19a-PB 156 CG4464-PB 1..156 17..172 812 100 Plus
RpS19a-PD 156 CG4464-PD 1..156 17..172 812 100 Plus

GM26647.pep Sequence

Translation from 49 to 519

> GM26647.pep
MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDP
DWFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAA
RKALQALEHARLVEKHPDGGRKLSSIGQRDLDRIANQIVFKQRDAAKQTG
PIVISK*

GM26647.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21022-PA 156 GF21022-PA 1..156 1..156 801 97.4 Plus
Dana\GF17022-PA 156 GF17022-PA 1..155 1..155 595 67.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19061-PA 156 GG19061-PA 1..156 1..156 817 99.4 Plus
Dere\GG12389-PA 155 GG12389-PA 1..154 1..155 578 69 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12611-PA 156 GH12611-PA 1..156 1..156 809 98.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
RpS19a-PE 156 CG4464-PE 1..156 1..156 812 100 Plus
RpS19a-PA 156 CG4464-PA 1..156 1..156 812 100 Plus
RpS19a-PC 156 CG4464-PC 1..156 1..156 812 100 Plus
RpS19a-PB 156 CG4464-PB 1..156 1..156 812 100 Plus
RpS19a-PD 156 CG4464-PD 1..156 1..156 812 100 Plus
RpS19b-PC 155 CG5338-PC 1..153 1..153 541 66.7 Plus
RpS19b-PB 155 CG5338-PB 1..153 1..153 541 66.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11025-PA 156 GI11025-PA 1..156 1..156 805 97.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27068-PA 156 GL27068-PA 1..156 1..156 806 97.4 Plus
Dper\GL18204-PA 156 GL18204-PA 1..156 1..156 806 97.4 Plus
Dper\GL13146-PA 151 GL13146-PA 1..151 1..156 694 87.2 Plus
Dper\GL24165-PA 163 GL24165-PA 1..151 1..153 540 62.1 Plus
Dper\GL15432-PA 104 GL15432-PA 1..88 28..151 224 45.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27710-PA 156 GA27710-PA 1..156 1..156 806 97.4 Plus
Dpse\GA18203-PA 156 GA18203-PA 1..156 1..156 806 97.4 Plus
Dpse\GA23235-PA 156 GA23235-PA 1..156 1..156 781 94.2 Plus
Dpse\GA18813-PA 163 GA18813-PA 1..151 1..153 549 62.7 Plus
Dpse\GA25986-PA 191 GA25986-PA 37..155 10..136 451 74 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13451-PA 134 GM13451-PA 1..134 23..156 705 99.3 Plus
Dsec\GM23526-PA 155 GM23526-PA 1..154 1..155 541 64.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17290-PA 169 GD17290-PA 1..156 1..156 816 99.4 Plus
Dsim\GD18336-PA 155 GD18336-PA 1..154 1..155 541 64.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15624-PA 156 GJ15624-PA 1..156 1..156 806 98.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25712-PA 153 GK25712-PA 1..153 1..153 790 96.7 Plus
Dwil\GK22513-PA 156 GK22513-PA 1..155 1..155 611 70.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS19a-PA 156 GE17282-PA 1..156 1..156 817 99.4 Plus
Dyak\GE10844-PA 155 GE10844-PA 1..155 1..155 575 67.1 Plus