Clone GM26747 Report

Search the DGRC for GM26747

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:267
Well:47
Vector:pOT2
Associated Gene/TranscriptCG9603-RA
Protein status:GM26747.pep: gold
Sequenced Size:576

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9603-RA 2009-01-21 est gleaning

Clone Sequence Records

GM26747.complete Sequence

576 bp assembled on 2009-01-29

GenBank Submission: BT058048.1

> GM26747.complete
AGGAAAACTGCTCACTTTTTGCTAAATCTTAAAAATAAACCCCAGCAAAA
TGATGAACCTGTCGAGAGCTGTTGTCCGTAGCTTCGCTACCACCGCTGGC
CGCCGGTCCGCCGCCGTGCCCAAGGACCAGATCGAGAAGGGATACTTCGA
GATCCGCAAGGTGCAGGAGCACTTTCAGAAGAAGGACGGCAAGCCCGTCT
TCCTCAAGGGATCCGTCGTGGACAACGTGCTCTACCGCGTCACCGTCGCT
CTCGCCCTCGTCGGCATCGGTGGCATGGGCAAGCTTTTCTACGAGCTGAG
TGTTCCCAAGAAGGAGTGAAGTCGCAGTACCGAACCCTAAGCTAAGCCAT
TAAACCCCGCGCAAGATCCGTGATTCAGCGTAGTCGCCTTATATTTCAAT
GTTTTGATTGTAGCCTTGCCCTGGATACCTGGACAACATGAAACACCCCA
ACCTACAACCTGGCTTATTGTTTTGTGTTAGAATAGCTAAGATTTGATGT
GTAAACTGAACATTCGCAAGAGCATTTAAAGCGTGGAAATATAAGAGATC
TGGCTGTAAAAAAAAAAAAAAAAAAA

GM26747.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG9603-RA 766 CG9603-RA 63..622 1..560 2800 100 Plus
CG9603.a 613 CG9603.a 59..613 1..557 2730 99.6 Plus
CG9603.b 559 CG9603.b 70..559 68..557 2450 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4166441..4166784 411..68 1705 99.7 Minus
chr3R 27901430 chr3R 4165957..4166102 557..412 730 100 Minus
chr3R 27901430 chr3R 4166925..4166992 68..1 340 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:26:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8340428..8340771 411..68 1720 100 Minus
3R 32079331 3R 8339941..8340089 560..412 745 100 Minus
3R 32079331 3R 8340912..8340979 68..1 340 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8081259..8081602 411..68 1720 100 Minus
3R 31820162 3R 8080772..8080920 560..412 745 100 Minus
3R 31820162 3R 8081743..8081810 68..1 340 100 Minus
Blast to na_te.dros performed on 2019-03-16 17:21:35 has no hits.

GM26747.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:22:47 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4165957..4166102 412..557 100 <- Minus
chr3R 4166441..4166784 68..411 99 <- Minus
chr3R 4166926..4166992 1..67 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:03 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 1..270 50..319 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:29:11 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 1..270 50..319 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:41 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 1..270 50..319 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:57:07 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 1..270 50..319 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-29 16:55:27 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 63..619 1..557 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:29:11 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 63..619 1..557 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:41 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 65..621 1..557 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:57:07 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 65..621 1..557 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:22:47 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8339944..8340089 412..557 100 <- Minus
3R 8340428..8340771 68..411 100 <- Minus
3R 8340913..8340979 1..67 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:22:47 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8339944..8340089 412..557 100 <- Minus
3R 8340428..8340771 68..411 100 <- Minus
3R 8340913..8340979 1..67 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:22:47 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8339944..8340089 412..557 100 <- Minus
3R 8340428..8340771 68..411 100 <- Minus
3R 8340913..8340979 1..67 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:41 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4165666..4165811 412..557 100 <- Minus
arm_3R 4166150..4166493 68..411 100 <- Minus
arm_3R 4166635..4166701 1..67 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:02:01 Download gff for GM26747.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8081259..8081602 68..411 100 <- Minus
3R 8081744..8081810 1..67 100   Minus
3R 8080775..8080920 412..557 100 <- Minus

GM26747.pep Sequence

Translation from 49 to 318

> GM26747.pep
MMNLSRAVVRSFATTAGRRSAAVPKDQIEKGYFEIRKVQEHFQKKDGKPV
FLKGSVVDNVLYRVTVALALVGIGGMGKLFYELSVPKKE*

GM26747.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16667-PA 89 GF16667-PA 1..89 1..89 432 92.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17453-PA 89 GG17453-PA 1..89 1..89 449 96.6 Plus
Dere\GG10146-PA 103 GG10146-PA 26..92 10..75 134 43.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17420-PA 90 GH17420-PA 1..89 1..89 401 83.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
COX7A-PA 89 CG9603-PA 1..89 1..89 444 100 Plus
COX7A-PB 98 CG9603-PB 16..98 7..89 415 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22749-PA 90 GI22749-PA 1..89 1..89 413 87.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24117-PA 89 GL24117-PA 1..89 1..89 407 88.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21907-PA 89 GA21907-PA 1..89 1..89 404 87.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26348-PA 89 GM26348-PA 1..89 1..89 458 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20874-PA 89 GD20874-PA 1..89 1..89 449 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22750-PA 90 GJ22750-PA 1..89 1..89 406 84.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14100-PA 90 GK14100-PA 1..89 1..89 408 87.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24854-PA 89 GE24854-PA 1..89 1..89 449 97.8 Plus

GM26747.hyp Sequence

Translation from 49 to 318

> GM26747.hyp
MMNLSRAVVRSFATTAGRRSAAVPKDQIEKGYFEIRKVQEHFQKKDGKPV
FLKGSVVDNVLYRVTVALALVGIGGMGKLFYELSVPKKE*

GM26747.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9603-PA 89 CG9603-PA 1..89 1..89 444 100 Plus
CG9603-PB 98 CG9603-PB 16..98 7..89 415 100 Plus