Clone GM27569 Report

Search the DGRC for GM27569

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:275
Well:69
Vector:pOT2
Associated Gene/Transcripttrsn-RA
Protein status:GM27569.pep: gold
Preliminary Size:708
Sequenced Size:886

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11761 2002-01-01 Sim4 clustering to Release 2
CG11761 2002-05-18 Blastp of sequenced clone
CG11761 2003-01-01 Sim4 clustering to Release 3
trsn 2008-04-29 Release 5.5 accounting
trsn 2008-08-15 Release 5.9 accounting
trsn 2008-12-18 5.12 accounting

Clone Sequence Records

GM27569.complete Sequence

886 bp (886 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118870

> GM27569.complete
CGGCACGAGCTTGGCTATACTCCCATCCCTATCGCCGGTATAAACAACTA
AGAAAAGCAGCAAAACATTAAGCAAAAATGTCGAACTTCGTGAACTTGGA
CATCTTCTCCAACTACCAAAAGTACATAGACAATGAACAGGAAGTCAGGG
AGAACATTCGCATTGTGGTGCGCGAAATCGAGCATTTGTCAAAGGAAGCG
CAGATTAAACTGCAGATTATTCATAGCGATTTGAGCCAGATTAGTGCCGC
CTGCGGCTTAGCCCGCAAACAGGTTGAGCTGTGTGCCCAAAAGTACCAGA
AATTGGCCGAACTGGTGCCAGCTGGGCAGTACTACAGATACTCCGATCAC
TGGACCTTCATTACGCAGCGTTTGATCTTCATCATTGCCTTGGTTATTTA
CCTGGAGGCGGGCTTCTTGGTCACCCGCGAAACAGTGGCCGAAATGCTGG
GATTGAAGATCAGCCAGTCTGAGGGCTTCCATCTGGATGTGGAGGACTAT
CTACTGGGCATACTGCAGTTGGCGTCGGAGCTCTCCCGATTCGCTACCAA
TTCCGTCACCATGGGCGACTACGAGCGTCCCCTGAATATCTCCCATTTTA
TTGGTGACCTGAACACGGGCTTCCGTCTGCTGAACCTGAAGAACGATGGC
TTGCGAAAGCGCTTCGATGCCTTAAAGTATGATGTCAAGAAGATCGAGGA
GGTCGTCTACGATGTCAGCATACGCGGTCTGTCCAGCAAGGAAAAGGACC
AGCAGGAGGAGCCGGCTGTTCCTGCAACCGAATAGTTTACTTCGTACGTA
GGATAAGGCGTTTATTAAAATGAAAAAGTTTCATTTAAACAAGCAAATAT
ATTACATTCATTAAACAGAAAAAAAAAAAAAAAAAA

GM27569.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
trsn-RA 889 trsn-RA 22..882 9..869 4275 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6366566..6366980 868..454 2075 100 Minus
chr2R 21145070 chr2R 6367519..6367662 152..9 705 99.3 Minus
chr2R 21145070 chr2R 6367037..6367155 453..335 580 99.2 Minus
chr2R 21145070 chr2R 6367215..6367311 337..241 485 100 Minus
chr2R 21145070 chr2R 6367378..6367467 240..151 435 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:26:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10479010..10479425 869..454 2080 100 Minus
2R 25286936 2R 10479964..10480107 152..9 705 99.3 Minus
2R 25286936 2R 10479482..10479600 453..335 595 100 Minus
2R 25286936 2R 10479660..10479756 337..241 485 100 Minus
2R 25286936 2R 10479823..10479912 240..151 435 98.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10480209..10480624 869..454 2080 100 Minus
2R 25260384 2R 10481163..10481306 152..9 705 99.3 Minus
2R 25260384 2R 10480681..10480799 453..335 595 100 Minus
2R 25260384 2R 10480859..10480955 337..241 485 100 Minus
2R 25260384 2R 10481022..10481111 240..151 435 98.8 Minus
Blast to na_te.dros performed on 2019-03-15 12:33:34 has no hits.

GM27569.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:34:39 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6367519..6367662 9..152 99   Minus
chr2R 6366566..6366980 454..868 100 <- Minus
chr2R 6367037..6367152 338..453 99 <- Minus
chr2R 6367215..6367311 241..337 100 <- Minus
chr2R 6367378..6367465 153..240 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:28 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
trsn-RA 1..708 78..785 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:17:51 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
trsn-RA 1..708 78..785 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:45:24 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
trsn-RA 1..708 78..785 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:09:01 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
trsn-RA 1..708 78..785 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:03:29 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
trsn-RA 1..708 78..785 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:42:24 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
trsn-RA 1..860 9..868 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:17:51 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
trsn-RA 22..881 9..868 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:45:24 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
trsn-RA 2..864 8..868 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:15 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
trsn-RA 1..860 9..868 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:03:29 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
trsn-RA 2..864 8..868 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:39 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10479660..10479756 241..337 100 <- Minus
2R 10479823..10479910 153..240 98 <- Minus
2R 10479964..10480107 9..152 99   Minus
2R 10479011..10479425 454..868 100 <- Minus
2R 10479482..10479597 338..453 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:39 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10479660..10479756 241..337 100 <- Minus
2R 10479823..10479910 153..240 98 <- Minus
2R 10479964..10480107 9..152 99   Minus
2R 10479011..10479425 454..868 100 <- Minus
2R 10479482..10479597 338..453 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:34:39 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10479660..10479756 241..337 100 <- Minus
2R 10479823..10479910 153..240 98 <- Minus
2R 10479964..10480107 9..152 99   Minus
2R 10479011..10479425 454..868 100 <- Minus
2R 10479482..10479597 338..453 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:45:24 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6366516..6366930 454..868 100 <- Minus
arm_2R 6366987..6367102 338..453 100 <- Minus
arm_2R 6367165..6367261 241..337 100 <- Minus
arm_2R 6367328..6367415 153..240 98 <- Minus
arm_2R 6367469..6367612 9..152 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:41:02 Download gff for GM27569.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10480210..10480624 454..868 100 <- Minus
2R 10480681..10480796 338..453 100 <- Minus
2R 10480859..10480955 241..337 100 <- Minus
2R 10481022..10481109 153..240 98 <- Minus
2R 10481163..10481306 9..152 99   Minus

GM27569.pep Sequence

Translation from 77 to 784

> GM27569.pep
MSNFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHS
DLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLI
FIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLAS
ELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLKNDGLRKRFDALK
YDVKKIEEVVYDVSIRGLSSKEKDQQEEPAVPATE*

GM27569.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11105-PA 235 GF11105-PA 1..235 1..235 1154 90.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22742-PA 235 GG22742-PA 1..235 1..235 1172 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20630-PA 234 GH20630-PA 1..232 1..232 1065 84.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
trsn-PA 235 CG11761-PA 1..235 1..235 1183 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20191-PA 234 GI20191-PA 1..234 1..235 1047 82.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17199-PA 233 GL17199-PA 1..231 1..232 1083 87.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11181-PA 233 GA11181-PA 1..231 1..232 1083 87.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20518-PA 232 GM20518-PA 1..232 1..235 1093 90.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25978-PA 230 GD25978-PA 1..230 1..235 1175 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20139-PA 234 GJ20139-PA 1..232 1..232 1053 83.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10677-PA 236 GK10677-PA 5..234 2..229 1040 85.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13101-PA 235 GE13101-PA 1..235 1..235 1188 94.9 Plus

GM27569.hyp Sequence

Translation from 77 to 784

> GM27569.hyp
MSNFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHS
DLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLI
FIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLAS
ELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLKNDGLRKRFDALK
YDVKKIEEVVYDVSIRGLSSKEKDQQEEPAVPATE*

GM27569.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
trsn-PA 235 CG11761-PA 1..235 1..235 1183 100 Plus