Clone GM28229 Report

Search the DGRC for GM28229

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:282
Well:29
Vector:pOT2
Associated Gene/TranscriptCG34200-RA
Protein status:GM28229.pep: gold
Sequenced Size:305

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34200 2008-04-29 Release 5.5 accounting
CG34200 2008-08-15 Release 5.9 accounting
CG34200 2008-12-18 5.12 accounting

Clone Sequence Records

GM28229.complete Sequence

305 bp (305 high quality bases) assembled on 2006-06-13

GenBank Submission: BT028770

> GM28229.complete
CATTTCCTCGTGCACAAAACAAAATAACAAAATCGAGCTGAAAATAAAAA
TATCCGAAGAATCCGATCAAAATGGTAAAGTCTTCAAATCCCCTGAGCAT
CGTGCGCAGCATTTACAACAACGAATTTCAATGGATGCTGGTCAAGAGCT
ACGGACTTTTCTTCTTGGGAGTGCGTTTGGCCAAGGAGTTCGTGGGTGTC
GAACTGATGCCGTCGCTGGGGCCAGCCTAAGAGTACTACCAACATTTAAA
AATTCCAAAACGGCAATTAAAGATAACTTAGTATAATATTAAAAAAAAAA
AAAAA

GM28229.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG34200-RA 500 CG34200-RA 163..453 1..291 1440 99.6 Plus
CG7791-RA 2362 CG7791-RA 2326..2362 291..255 185 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1645295..1645452 133..290 790 100 Plus
chr2R 21145070 chr2R 1645078..1645211 1..134 655 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:26:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5757910..5758068 133..291 795 100 Plus
2R 25286936 2R 5757693..5757826 1..134 655 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5759109..5759267 133..291 795 100 Plus
2R 25260384 2R 5758892..5759025 1..134 655 99.2 Plus
Blast to na_te.dros performed on 2019-03-16 17:55:13 has no hits.

GM28229.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:55:55 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1645296..1645452 134..290 100   Plus
chr2R 1645078..1645210 1..133 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:29 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 1..159 72..230 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:39 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 1..159 72..230 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:03:42 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 1..159 72..230 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:48 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 1..159 72..230 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:22:54 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 1..159 72..230 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:40 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 1..290 1..290 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:39 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 1..290 1..290 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:03:42 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 32..321 1..290 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:48 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 1..290 1..290 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:22:54 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 32..321 1..290 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:55 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5757693..5757825 1..133 99 -> Plus
2R 5757911..5758067 134..290 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:55 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5757693..5757825 1..133 99 -> Plus
2R 5757911..5758067 134..290 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:55:55 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5757693..5757825 1..133 99 -> Plus
2R 5757911..5758067 134..290 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:03:42 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1645198..1645330 1..133 99 -> Plus
arm_2R 1645416..1645572 134..290 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:34 Download gff for GM28229.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5758892..5759024 1..133 99 -> Plus
2R 5759110..5759266 134..290 100   Plus

GM28229.hyp Sequence

Translation from 0 to 285

> GM28229.hyp
ISSCTKQNNKIELKIKISEESDQNGKVFKSPEHRAQHLQQRVSMDAGQEL
RTFLLGSAFGQGVRGCRTDAVAGASLRVLPTFKNSKTAIKDNLV*
Sequence GM28229.hyp has no blast hits.

GM28229.pep Sequence

Translation from 71 to 229

> GM28229.pep
MVKSSNPLSIVRSIYNNEFQWMLVKSYGLFFLGVRLAKEFVGVELMPSLG
PA*

GM28229.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11030-PA 52 GF11030-PA 1..52 1..52 254 94.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23180-PA 52 GG23180-PA 1..52 1..52 254 94.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24964-PA 52 GH24964-PA 1..52 1..52 215 73.1 Plus
Dgri\GH21652-PA 52 GH21652-PA 1..52 1..52 215 73.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG34200-PA 52 CG34200-PA 1..52 1..52 264 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20106-PA 52 GI20106-PA 1..52 1..52 218 75 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20047-PA 52 GL20047-PA 1..52 1..52 226 82.7 Plus
Dper\GL23172-PA 52 GL23172-PA 1..52 1..52 164 57.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24262-PA 52 GA24262-PA 1..52 1..52 226 82.7 Plus
Dpse\GA27173-PA 52 GA27173-PA 1..52 1..52 175 61.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16520-PA 52 GM16520-PA 1..52 1..52 263 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10384-PA 52 GD10384-PA 1..52 1..52 263 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19873-PA 52 GJ19873-PA 1..52 1..52 212 73.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23210-PA 52 GK23210-PA 1..50 1..50 218 80 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20572-PA 52 GE20572-PA 1..52 1..52 250 94.2 Plus