Clone GM30016 Report

Search the DGRC for GM30016

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:300
Well:16
Vector:pOT2
Associated Gene/TranscriptCG14550-RA
Protein status:GM30016.pep2: gold GM30016.pep: gold
Preliminary Size:417
Sequenced Size:830

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14550 2002-01-01 Sim4 clustering to Release 2
CG14550 2002-05-18 Blastp of sequenced clone
CG14550 2003-01-01 Sim4 clustering to Release 3
CG14550 2008-04-29 Release 5.5 accounting
CG14550 2008-08-15 Release 5.9 accounting
CG14550 2008-12-18 5.12 accounting

Clone Sequence Records

GM30016.complete Sequence

830 bp (830 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118873.1

> GM30016.complete
TTGACATGTGAGCATTTCAGATTGGTTAAAACTTTTATGATGCCACAAAT
TGCAAATAAACCAAATGAATCCATAATAAGAGTGCCGTTTGAGACGCCAC
GATTGGCCGAGATCGCCTACAAAGTCCTCGGTGTCGACCAGGAGCCGCGC
CGGAATTTCGTGAAAAAAACTTTGAGCCTGGAGAACGATGTTCTGGTTGT
GCACTTTCAGTCGGATCAAGTGAAGAGCCTGCGCACTGCCATCACCTCCT
TCTTTGAGTGCCTGCTCCTGTGCCAGGACACCATCAACCAGTTCGGAGAC
TCCAAGAAAGAGAAACTAATCCCCGAGAGCAACGACAATGCCGGAACACA
CTCCAGCTCCGACTCCCCATAGGGCGGTCTATGGTTTCGCCTTCTATATG
CTGTTCACGGTCCTCTTCCTCGTATACGTGACTTGGGCGCTGCTGCCAGT
GGAGTTTGGTCTGCACTCGTATCTGCCGGACAAGTATTTTGCCGTATTTG
TGCCTTTTCTGGTGCTGGTCTTCGCCTGGTTCTTTGCCTTCCTCATCTAT
CCTGCCATAAATCTATCGATGACAGTGGATGTTGATTCCATTGCCTCGGT
GGTGGATCCAAAGCTGGCACTGCCCAAGGGGACAGAGTTCACCTCCTGGT
CGCAGTTGCAAAAAGGCAAGGTCAGCCAGGATTCCGCATCAAAGAAGGCC
TCTCCAGTGAACTGCAACCTGTGCAGGACTTTCCACCAACCTGTGACACG
TGCACCTATTCCACCACTGCGTTTTCTGGACCTCCAGGAAGTAAATACAG
CGTATTATAACTAAAAAAAAAAAAAAAAAA

GM30016.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42498-RA 814 CG42498-RA 1..814 1..814 4070 100 Plus
CG14550-RA 814 CG14550-RA 1..814 1..814 4070 100 Plus
CG14543-RA 754 CG14543-RA 678..754 818..742 385 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:55:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21880335..21881075 812..72 3525 98.4 Minus
chr3R 27901430 chr3R 21881139..21881209 71..1 355 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:26:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26057343..26058089 818..72 3735 100 Minus
3R 32079331 3R 26058153..26058223 71..1 355 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25798174..25798920 818..72 3735 100 Minus
3R 31820162 3R 25798984..25799054 71..1 355 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:55:44 has no hits.

GM30016.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:56:35 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21880335..21881075 72..812 98 <- Minus
chr3R 21881139..21881209 1..71 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:33 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14550-RA 1..475 338..812 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:10 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14550-RA 1..475 338..812 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:02 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14550-RA 1..477 338..814 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:37:23 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14550-RA 1..475 338..812 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:45:28 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14550-RA 1..477 338..814 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:20:25 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14550-RA 1..812 1..812 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:10 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
CG42498-RA 1..812 1..812 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:02 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
CG42498-RA 1..812 1..812 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:37:23 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14550-RA 1..812 1..812 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:45:28 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14550-RA 1..812 1..812 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:56:35 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26057349..26058089 72..812 100 <- Minus
3R 26058153..26058223 1..71 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:56:35 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26057349..26058089 72..812 100 <- Minus
3R 26058153..26058223 1..71 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:56:35 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26057349..26058089 72..812 100 <- Minus
3R 26058153..26058223 1..71 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:02 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21883071..21883811 72..812 100 <- Minus
arm_3R 21883875..21883945 1..71 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:09:46 Download gff for GM30016.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25798984..25799054 1..71 100   Minus
3R 25798180..25798920 72..812 100 <- Minus

GM30016.pep2 Sequence

Translation from 36 to 371

> GM30016.pep2
MMPQIANKPNESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLEN
DVLVVHFQSDQVKSLRTAITSFFECLLLCQDTINQFGDSKKEKLIPESND
NAGTHSSSDSP*

GM30016.pep2 Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG42498-PA 111 CG42498-PA 1..111 1..111 567 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12800-PA 97 GK12800-PA 1..96 2..110 380 68.8 Plus

GM30016.hyp Sequence

Translation from 337 to 811

> GM30016.hyp
MPEHTPAPTPHRAVYGFAFYMLFTVLFLVYVTWALLPVEFGLHSYLPDKY
FAVFVPFLVLVFAWFFAFLIYPAINLSMTVDVDSIASVVDPKLALPKGTE
FTSWSQLQKGKVSQDSASKKASPVNCNLCRTFHQPVTRAPIPPLRFLDLQ
EVNTAYYN

GM30016.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14550-PA 158 CG14550-PA 1..158 1..158 841 100 Plus

GM30016.pep Sequence

Translation from 337 to 813

> GM30016.pep
MPEHTPAPTPHRAVYGFAFYMLFTVLFLVYVTWALLPVEFGLHSYLPDKY
FAVFVPFLVLVFAWFFAFLIYPAINLSMTVDVDSIASVVDPKLALPKGTE
FTSWSQLQKGKVSQDSASKKASPVNCNLCRTFHQPVTRAPIPPLRFLDLQ
EVNTAYYN*

GM30016.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19935-PA 157 GF19935-PA 1..157 1..158 690 81.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12200-PA 138 GG12200-PA 1..138 21..158 687 95.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18141-PA 158 GH18141-PA 1..158 1..158 571 69.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
PIG-P-PA 158 CG14550-PA 1..158 1..158 841 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22903-PA 158 GI22903-PA 1..158 1..158 585 70.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22012-PA 157 GL22012-PA 1..157 1..158 678 80.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27346-PA 157 GA27346-PA 1..157 1..158 678 80.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10198-PA 138 GM10198-PA 1..138 21..158 698 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18148-PA 158 GD18148-PA 1..158 1..158 814 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23315-PA 157 GJ23315-PA 1..157 1..158 587 73 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10644-PA 158 GE10644-PA 1..158 1..158 790 94.9 Plus