Clone GM30351 Report

Search the DGRC for GM30351

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:303
Well:51
Vector:pOT2
Associated Gene/TranscriptCG42808-RA
Protein status:GM30351.pep: gold
Sequenced Size:643

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13335 2002-11-11 Blastp of sequenced clone
CG13335 2008-04-29 Release 5.5 accounting

Clone Sequence Records

GM30351.complete Sequence

643 bp (643 high quality bases) assembled on 2002-11-11

GenBank Submission: BT001466

> GM30351.complete
CAATCTCGTTGTGAATAGATCGAACTGTTGGAAAAGTAAAAACAAAAACA
GAGTTCAAAAATGCCGCTGCGCAAGAAAGAGGACTACATACCCATTAAGT
GCGAGGGCTGGAACGGCAAGTTCGTGTATCCGGATGGAGCTGTCAATAAT
GTGTCCAAGATACGTCGCCAGAACCAGAACGTAACCAATACCAACAACTT
CTACGGATTCAACACGGAACCCATTGTCCTGCCCACCGAATGGGATGGCA
CCTTCGTGAAGAGTGGCGAGACCCGCATCAAACAGGAGCGCAATCGATCC
GATGACCAGGACTACTTTGATTACAACACCGAGCCCACGGTACTGCCCAC
CACTTGGAGTGGCGAGTTCGTCAACGATCCCAACGATGTGCGCATTAAGC
CGGAACGCAACTTCTCGGATGCCAGGGATTATGCAGAGGCATCCCGATTC
AAACTGGTCCAGCACTGAGTGAGATCCCGATCCGCCCGTTTCAATCAAAC
TAATCCTGCAAATGTTGCGTTTGTTTCGGTTTCGCATTGTAATTGTCGCC
TAACCTAAGCGTTTGTTGTATTTTATTTTTTATGATATTTATTCGTATAC
TTAATAAACCAAAAAAAAAAAACACAAAAAAAAAAAAAAAAAA

GM30351.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13335-RB 2813 CG13335-RB 19..643 1..625 3125 100 Plus
CG13335-RA 1526 CG13335-RA 1..443 14..456 2215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9460919..9461543 625..1 3125 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:26:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13573618..13574242 625..1 3125 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13574817..13575441 625..1 3125 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:11:27 has no hits.

GM30351.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:12:25 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9460934..9461543 1..610 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:34 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
CG13335-RA 1..402 61..462 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:05:42 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
CG42808-RA 1..408 61..468 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:03:14 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
CG42808-RA 1..408 61..468 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:40 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
CG13335-RA 1..402 61..462 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:21:44 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
CG42808-RA 1..408 61..468 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:25:08 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
CG13335-RB 1..597 14..610 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:05:42 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
CG42808-RA 1..610 1..610 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:03:14 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
CG42808-RA 16..625 1..610 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:40 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
CG13335-RB 1..597 14..610 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:21:44 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
CG42808-RA 16..625 1..610 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:12:25 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13573633..13574242 1..610 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:12:25 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13573633..13574242 1..610 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:12:25 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13573633..13574242 1..610 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:03:14 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9461138..9461747 1..610 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:28:02 Download gff for GM30351.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13574832..13575441 1..610 100   Minus

GM30351.pep Sequence

Translation from 60 to 467

> GM30351.pep
MPLRKKEDYIPIKCEGWNGKFVYPDGAVNNVSKIRRQNQNVTNTNNFYGF
NTEPIVLPTEWDGTFVKSGETRIKQERNRSDDQDYFDYNTEPTVLPTTWS
GEFVNDPNDVRIKPERNFSDARDYAEASRFKLVQH*

GM30351.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11170-PA 135 GF11170-PA 1..135 1..135 594 89.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22479-PA 410 GG22479-PA 1..134 1..134 714 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20068-PA 135 GH20068-PA 1..135 1..135 624 84.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42808-PA 135 CG13335-PA 1..135 1..135 740 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18785-PA 134 GI18785-PA 1..134 1..134 596 91 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17006-PA 135 GL17006-PA 1..135 1..135 656 90.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12215-PA 135 GA12215-PA 1..135 1..135 656 90.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20263-PA 115 GM20263-PA 1..115 1..135 581 85.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25749-PA 410 GD25749-PA 1..134 1..134 727 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21811-PA 135 GJ21811-PA 1..135 1..135 603 91.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15606-PA 135 GK15606-PA 1..134 1..134 625 87.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:30:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13348-PA 410 GE13348-PA 1..134 1..134 714 96.3 Plus

GM30351.hyp Sequence

Translation from 60 to 467

> GM30351.hyp
MPLRKKEDYIPIKCEGWNGKFVYPDGAVNNVSKIRRQNQNVTNTNNFYGF
NTEPIVLPTEWDGTFVKSGETRIKQERNRSDDQDYFDYNTEPTVLPTTWS
GEFVNDPNDVRIKPERNFSDARDYAEASRFKLVQH*

GM30351.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42808-PA 135 CG13335-PA 1..135 1..135 740 100 Plus