BDGP Sequence Production Resources |
Search the DGRC for GM30351
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 303 |
Well: | 51 |
Vector: | pOT2 |
Associated Gene/Transcript | CG42808-RA |
Protein status: | GM30351.pep: gold |
Sequenced Size: | 643 |
Gene | Date | Evidence |
---|---|---|
CG13335 | 2002-11-11 | Blastp of sequenced clone |
CG13335 | 2008-04-29 | Release 5.5 accounting |
643 bp (643 high quality bases) assembled on 2002-11-11
GenBank Submission: BT001466
> GM30351.complete CAATCTCGTTGTGAATAGATCGAACTGTTGGAAAAGTAAAAACAAAAACA GAGTTCAAAAATGCCGCTGCGCAAGAAAGAGGACTACATACCCATTAAGT GCGAGGGCTGGAACGGCAAGTTCGTGTATCCGGATGGAGCTGTCAATAAT GTGTCCAAGATACGTCGCCAGAACCAGAACGTAACCAATACCAACAACTT CTACGGATTCAACACGGAACCCATTGTCCTGCCCACCGAATGGGATGGCA CCTTCGTGAAGAGTGGCGAGACCCGCATCAAACAGGAGCGCAATCGATCC GATGACCAGGACTACTTTGATTACAACACCGAGCCCACGGTACTGCCCAC CACTTGGAGTGGCGAGTTCGTCAACGATCCCAACGATGTGCGCATTAAGC CGGAACGCAACTTCTCGGATGCCAGGGATTATGCAGAGGCATCCCGATTC AAACTGGTCCAGCACTGAGTGAGATCCCGATCCGCCCGTTTCAATCAAAC TAATCCTGCAAATGTTGCGTTTGTTTCGGTTTCGCATTGTAATTGTCGCC TAACCTAAGCGTTTGTTGTATTTTATTTTTTATGATATTTATTCGTATAC TTAATAAACCAAAAAAAAAAAACACAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 9460919..9461543 | 625..1 | 3125 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 13573618..13574242 | 625..1 | 3125 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 13574817..13575441 | 625..1 | 3125 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 9460934..9461543 | 1..610 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13335-RA | 1..402 | 61..462 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42808-RA | 1..408 | 61..468 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42808-RA | 1..408 | 61..468 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13335-RA | 1..402 | 61..462 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42808-RA | 1..408 | 61..468 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13335-RB | 1..597 | 14..610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42808-RA | 1..610 | 1..610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42808-RA | 16..625 | 1..610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13335-RB | 1..597 | 14..610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42808-RA | 16..625 | 1..610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13573633..13574242 | 1..610 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13573633..13574242 | 1..610 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13573633..13574242 | 1..610 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 9461138..9461747 | 1..610 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13574832..13575441 | 1..610 | 100 | Minus |
Translation from 60 to 467
> GM30351.pep MPLRKKEDYIPIKCEGWNGKFVYPDGAVNNVSKIRRQNQNVTNTNNFYGF NTEPIVLPTEWDGTFVKSGETRIKQERNRSDDQDYFDYNTEPTVLPTTWS GEFVNDPNDVRIKPERNFSDARDYAEASRFKLVQH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11170-PA | 135 | GF11170-PA | 1..135 | 1..135 | 594 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22479-PA | 410 | GG22479-PA | 1..134 | 1..134 | 714 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20068-PA | 135 | GH20068-PA | 1..135 | 1..135 | 624 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42808-PA | 135 | CG13335-PA | 1..135 | 1..135 | 740 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18785-PA | 134 | GI18785-PA | 1..134 | 1..134 | 596 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17006-PA | 135 | GL17006-PA | 1..135 | 1..135 | 656 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12215-PA | 135 | GA12215-PA | 1..135 | 1..135 | 656 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20263-PA | 115 | GM20263-PA | 1..115 | 1..135 | 581 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25749-PA | 410 | GD25749-PA | 1..134 | 1..134 | 727 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21811-PA | 135 | GJ21811-PA | 1..135 | 1..135 | 603 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15606-PA | 135 | GK15606-PA | 1..134 | 1..134 | 625 | 87.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13348-PA | 410 | GE13348-PA | 1..134 | 1..134 | 714 | 96.3 | Plus |
Translation from 60 to 467
> GM30351.hyp MPLRKKEDYIPIKCEGWNGKFVYPDGAVNNVSKIRRQNQNVTNTNNFYGF NTEPIVLPTEWDGTFVKSGETRIKQERNRSDDQDYFDYNTEPTVLPTTWS GEFVNDPNDVRIKPERNFSDARDYAEASRFKLVQH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42808-PA | 135 | CG13335-PA | 1..135 | 1..135 | 740 | 100 | Plus |