Clone GM30486 Report

Search the DGRC for GM30486

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:304
Well:86
Vector:pOT2
Associated Gene/TranscriptCG34117-RA
Protein status:GM30486.pep: gold
Sequenced Size:415

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34117 2008-04-29 Release 5.5 accounting
CG34117 2008-08-15 Release 5.9 accounting
CG34117 2008-12-18 5.12 accounting

Clone Sequence Records

GM30486.complete Sequence

415 bp (415 high quality bases) assembled on 2006-06-13

GenBank Submission: BT028771.1

> GM30486.complete
GAATTTTCTTAAAAATCACAATGGCGGGAACCAAGGTGCTGCGCTCCCTG
CTGCACGAATTGCGCCAGGCATCTCCAAATGGCTGCATCAAGGACTCTCT
GGCCGCGCGCTACATTTTGGCGCAATACAAGAAGTTCGCCACCACGGAGC
AACAATTCTGCAAGGCGCGCAACGAAGCGACTTTCCTGGGTCAAACCTAC
CTGACCTACCTAGCCAGCCAGCGCCGGTACTTGGAGCTCTACAAGGAATA
TCACGGAAGGGGCGAGAGATCCGTAAGGGATACCGCCGATTTGGTGGGCT
TCAAGCTGCCCTCGGATCCCAAGTGATCTAGTTATATAGAAAGATAGTTA
CTAGCGTAGTGCGATTAAAGCGTCCCGATTTTGCAAACTCAAAAAAAAAA
AAAAAAAAAAAAAAA

GM30486.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34117-RA 517 CG34117-RA 61..450 1..390 1935 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5225403..5225773 390..20 1855 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:26:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9399570..9399940 390..20 1840 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9140401..9140771 390..20 1840 99.7 Minus
Blast to na_te.dros performed on 2019-03-15 20:02:48 has no hits.

GM30486.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:03:42 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5225403..5225773 20..390 100 <- Minus
chr3R 5225830..5225848 1..19 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:36 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 1..306 21..326 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:21:52 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 1..306 21..326 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:02:05 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 1..306 21..326 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:40:18 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 1..306 21..326 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:46 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 1..306 21..326 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:50:18 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 35..424 1..390 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:21:52 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 35..424 1..390 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:02:05 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 39..428 1..390 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:40:18 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 35..424 1..390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:46 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 39..428 1..390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:42 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9399570..9399940 20..390 99 <- Minus
3R 9399997..9400015 1..19 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:42 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9399570..9399940 20..390 99 <- Minus
3R 9399997..9400015 1..19 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:42 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9399570..9399940 20..390 99 <- Minus
3R 9399997..9400015 1..19 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:02:05 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5225292..5225662 20..390 99 <- Minus
arm_3R 5225719..5225737 1..19 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:50:25 Download gff for GM30486.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9140401..9140771 20..390 99 <- Minus
3R 9140828..9140846 1..19 100   Minus

GM30486.hyp Sequence

Translation from 0 to 330

> GM30486.hyp
NFLKNHNGGNQGAALPAARIAPGISKWLHQGLSGRALHFGAIQEVRHHGT
TILQGAQRSDFPGSNLPDLPSQPAPVLGALQGISRKGREIRKGYRRFGGL
QAALGSQVI*
Sequence GM30486.hyp has no blast hits.

GM30486.pep Sequence

Translation from 2 to 325

> GM30486.pep
IFLKITMAGTKVLRSLLHELRQASPNGCIKDSLAARYILAQYKKFATTEQ
QFCKARNEATFLGQTYLTYLASQRRYLELYKEYHGRGERSVRDTADLVGF
KLPSDPK*

GM30486.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17769-PA 101 GF17769-PA 1..101 7..107 477 88.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17380-PA 101 GG17380-PA 1..101 7..107 526 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18553-PA 102 GH18553-PA 1..102 7..107 431 81.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG34117-PA 101 CG34117-PA 1..101 7..107 521 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23603-PA 102 GI23603-PA 1..102 7..107 409 78.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13674-PA 101 GL13674-PA 1..101 7..107 457 83.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26987-PA 101 GA26987-PA 1..101 7..107 463 84.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26265-PA 101 GM26265-PA 1..101 7..107 517 96 Plus
Dsec\GM13623-PA 70 GM13623-PA 1..61 7..67 313 96.7 Plus
Dsec\GM23926-PA 70 GM23926-PA 1..61 7..67 313 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20802-PA 101 GD20802-PA 1..101 7..107 520 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23576-PA 102 GJ23576-PA 1..102 7..107 417 78.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11725-PA 101 GK11725-PA 1..101 7..107 440 81.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24783-PA 101 GE24783-PA 1..101 7..107 513 95 Plus