BDGP Sequence Production Resources |
Search the DGRC for GM30486
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 304 |
Well: | 86 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34117-RA |
Protein status: | GM30486.pep: gold |
Sequenced Size: | 415 |
Gene | Date | Evidence |
---|---|---|
CG34117 | 2008-04-29 | Release 5.5 accounting |
CG34117 | 2008-08-15 | Release 5.9 accounting |
CG34117 | 2008-12-18 | 5.12 accounting |
415 bp (415 high quality bases) assembled on 2006-06-13
GenBank Submission: BT028771.1
> GM30486.complete GAATTTTCTTAAAAATCACAATGGCGGGAACCAAGGTGCTGCGCTCCCTG CTGCACGAATTGCGCCAGGCATCTCCAAATGGCTGCATCAAGGACTCTCT GGCCGCGCGCTACATTTTGGCGCAATACAAGAAGTTCGCCACCACGGAGC AACAATTCTGCAAGGCGCGCAACGAAGCGACTTTCCTGGGTCAAACCTAC CTGACCTACCTAGCCAGCCAGCGCCGGTACTTGGAGCTCTACAAGGAATA TCACGGAAGGGGCGAGAGATCCGTAAGGGATACCGCCGATTTGGTGGGCT TCAAGCTGCCCTCGGATCCCAAGTGATCTAGTTATATAGAAAGATAGTTA CTAGCGTAGTGCGATTAAAGCGTCCCGATTTTGCAAACTCAAAAAAAAAA AAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34117-RA | 517 | CG34117-RA | 61..450 | 1..390 | 1935 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 5225403..5225773 | 390..20 | 1855 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 9399570..9399940 | 390..20 | 1840 | 99.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 9140401..9140771 | 390..20 | 1840 | 99.7 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 5225403..5225773 | 20..390 | 100 | <- | Minus |
chr3R | 5225830..5225848 | 1..19 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34117-RA | 1..306 | 21..326 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34117-RA | 1..306 | 21..326 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34117-RA | 1..306 | 21..326 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34117-RA | 1..306 | 21..326 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34117-RA | 1..306 | 21..326 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34117-RA | 35..424 | 1..390 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34117-RA | 35..424 | 1..390 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34117-RA | 39..428 | 1..390 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34117-RA | 35..424 | 1..390 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34117-RA | 39..428 | 1..390 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9399570..9399940 | 20..390 | 99 | <- | Minus |
3R | 9399997..9400015 | 1..19 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9399570..9399940 | 20..390 | 99 | <- | Minus |
3R | 9399997..9400015 | 1..19 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9399570..9399940 | 20..390 | 99 | <- | Minus |
3R | 9399997..9400015 | 1..19 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 5225292..5225662 | 20..390 | 99 | <- | Minus |
arm_3R | 5225719..5225737 | 1..19 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9140401..9140771 | 20..390 | 99 | <- | Minus |
3R | 9140828..9140846 | 1..19 | 100 | Minus |
Translation from 0 to 330
> GM30486.hyp NFLKNHNGGNQGAALPAARIAPGISKWLHQGLSGRALHFGAIQEVRHHGT TILQGAQRSDFPGSNLPDLPSQPAPVLGALQGISRKGREIRKGYRRFGGL QAALGSQVI*
Translation from 2 to 325
> GM30486.pep IFLKITMAGTKVLRSLLHELRQASPNGCIKDSLAARYILAQYKKFATTEQ QFCKARNEATFLGQTYLTYLASQRRYLELYKEYHGRGERSVRDTADLVGF KLPSDPK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17769-PA | 101 | GF17769-PA | 1..101 | 7..107 | 477 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17380-PA | 101 | GG17380-PA | 1..101 | 7..107 | 526 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18553-PA | 102 | GH18553-PA | 1..102 | 7..107 | 431 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34117-PA | 101 | CG34117-PA | 1..101 | 7..107 | 521 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23603-PA | 102 | GI23603-PA | 1..102 | 7..107 | 409 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13674-PA | 101 | GL13674-PA | 1..101 | 7..107 | 457 | 83.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26987-PA | 101 | GA26987-PA | 1..101 | 7..107 | 463 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26265-PA | 101 | GM26265-PA | 1..101 | 7..107 | 517 | 96 | Plus |
Dsec\GM13623-PA | 70 | GM13623-PA | 1..61 | 7..67 | 313 | 96.7 | Plus |
Dsec\GM23926-PA | 70 | GM23926-PA | 1..61 | 7..67 | 313 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20802-PA | 101 | GD20802-PA | 1..101 | 7..107 | 520 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23576-PA | 102 | GJ23576-PA | 1..102 | 7..107 | 417 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11725-PA | 101 | GK11725-PA | 1..101 | 7..107 | 440 | 81.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24783-PA | 101 | GE24783-PA | 1..101 | 7..107 | 513 | 95 | Plus |