Clone GM31526 Report

Search the DGRC for GM31526

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:315
Well:26
Vector:pOT2
Associated Gene/TranscriptCG14817-RA
Protein status:GM31526.pep: gold
Preliminary Size:486
Sequenced Size:465

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14817 2002-01-01 Sim4 clustering to Release 2
CG14817 2008-04-29 Stopped prior to 5.5
CG14817-RA 2009-01-21 est gleaning

Clone Sequence Records

GM31526.complete Sequence

465 bp assembled on 2011-04-22

GenBank Submission: BT126349.1

> GM31526.complete
ATTATAAAATAAAAAGTTAGCGGATTGAAGTAGTTTTTACTTGGCACTTG
AGCAACAAAATGCACCTGACGCTGATCAATTTGTTCAAGAAGACTGTGCC
CGGCCACATATTCCGGGGCAAGCGGCGCCTGGTGAAACCGGTCAGTCAGC
GAGCAATGGACACCCTGACCCACGAGTACGAGCGCCAGGAGCAGGTAATG
TTACTCCTCCGACACCCGTATCTCACCATGGAGCAGTCATTCGGTCATGC
CAAGGAGCTGCAGAAGCGCGAGAAGCTCGTTGCCAGATGGACGGACGAGC
AGACACTGCGCAAGATGAAGCCACACGTTACCATCGAGGAGCGGCTGAAC
CAGCTGAAGATCAAGGAGGCCTGGGACTAGCCGTCGTCGCAGCTGCTAAA
CCGGCGTTATTTGTTAAATAAATCTAGATTTATGGAAATTAAAAAAAAAA
AAAAAAAAAAAAAAA

GM31526.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1770811..1771041 231..1 1155 100 Minus
chrX 22417052 chrX 1770544..1770755 440..230 1010 99.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1876968..1877198 231..1 1155 100 Minus
X 23542271 X 1876700..1876912 441..230 1015 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1885066..1885296 231..1 1155 100 Minus
X 23527363 X 1884798..1885010 441..230 1025 99.5 Minus
Blast to na_te.dros performed on 2019-03-16 23:19:34 has no hits.

GM31526.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:20:41 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1770544..1770754 231..440 99 <- Minus
chrX 1770812..1771026 16..230 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-22 12:25:00 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
CG14817-RA 1..321 60..380 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:05:45 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
CG14817-RA 1..321 60..380 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:37:11 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
CG14817-RA 1..321 60..380 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-22 12:24:59 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
CG14817-RA 1..437 1..436 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:05:45 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
CG14817-RA 73..508 1..435 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:37:11 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
CG14817-RB 73..513 1..440 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:20:41 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
X 1876701..1876911 231..440 99 <- Minus
X 1876969..1877198 1..230 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:20:41 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
X 1876701..1876911 231..440 99 <- Minus
X 1876969..1877198 1..230 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:20:41 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
X 1876701..1876911 231..440 99 <- Minus
X 1876969..1877198 1..230 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:05:45 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1770734..1770944 231..440 99 <- Minus
arm_X 1771002..1771231 1..230 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:06:18 Download gff for GM31526.complete
Subject Subject Range Query Range Percent Splice Strand
X 1884799..1885009 231..440 99 <- Minus
X 1885067..1885296 1..230 100   Minus

GM31526.pep Sequence

Translation from 59 to 379

> GM31526.pep
MHLTLINLFKKTVPGHIFRGKRRLVKPVSQRAMDTLTHEYERQEQVMLLL
RHPYLTMEQSFGHAKELQKREKLVARWTDEQTLRKMKPHVTIEERLNQLK
IKEAWD*

GM31526.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21933-PA 106 GF21933-PA 1..106 1..106 499 89.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12674-PA 106 GG12674-PA 1..106 1..106 529 95.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24245-PA 106 GH24245-PA 1..106 1..106 469 83 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14817-PB 106 CG14817-PB 1..106 1..106 553 100 Plus
CG14817-PA 106 CG14817-PA 1..106 1..106 553 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21440-PA 106 GI21440-PA 1..106 1..106 470 83 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13375-PA 106 GL13375-PA 1..106 1..106 481 84 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13270-PA 106 GA13270-PA 1..106 1..106 478 84 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18946-PA 106 GM18946-PA 1..106 1..106 539 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16410-PA 106 GD16410-PA 1..106 1..106 539 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16460-PA 106 GJ16460-PA 1..106 1..106 476 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16184-PA 106 GK16184-PA 1..106 1..106 496 87.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17002-PA 106 GE17002-PA 1..106 1..106 527 95.3 Plus
Dyak\GE16502-PA 106 GE16502-PA 1..106 1..106 526 94.3 Plus

GM31526.hyp Sequence

Translation from 59 to 379

> GM31526.hyp
MHLTLINLFKKTVPGHIFRGKRRLVKPVSQRAMDTLTHEYERQEQVMLLL
RHPYLTMEQSFGHAKELQKREKLVARWTDEQTLRKMKPHVTIEERLNQLK
IKEAWD*

GM31526.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG14817-PB 106 CG14817-PB 1..106 1..106 553 100 Plus
CG14817-PA 106 CG14817-PA 1..106 1..106 553 100 Plus