BDGP Sequence Production Resources |
Search the DGRC for GM32296
Library: | GM |
Tissue Source: | Drosophila melanogaster ovary |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 322 |
Well: | 96 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32856-RA |
Protein status: | GM32296.pep: validated not full length |
Sequenced Size: | 410 |
Gene | Date | Evidence |
---|---|---|
CG32856 | 2002-10-15 | Blastp of sequenced clone |
CG32856 | 2008-04-29 | Release 5.5 accounting |
CG32856 | 2008-08-15 | Release 5.9 accounting |
CG32856 | 2008-12-18 | 5.12 accounting |
410 bp (410 high quality bases) assembled on 2002-10-15
GenBank Submission: BT001467
> GM32296.complete ACAAATCGAGTCCTTCAAAAAGAGCAGGCTGAACTATTTGCTATCCAGAA GAAACTCGACCGAGTGCTCCCCGTCATTCAGGAGGCATTAAATTCACTAA AGGTAGAGGAGCTGCATCTCAAGTCTCAGGTGGTGGGCCAGCAGAACCCA AAAACGCAGTGCTCCCCTGGAAGGGATCCCCTCCACATAGATCTGTCGGT GGAGCAGTCCCCAATCACAACTGTGATGGAGTCCCATCTCGTCAACAGCC AGCAAATAGATCTGGATCTCGTAAGCCAAATGAGGCGTTTCGAGGAGGAA GTCGACTCGGATTAAAATTGTTATTAAGGCTGGAACTTTACCAGAAAAAC GTACATGTTGGGAGCATTAAAATATAAACAATACAGTAAAAAAAAAAAAA AAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 11789333..11789617 | 103..387 | 100 | <- | Minus |
chr3R | 11789672..11789773 | 1..102 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32856-RA | 10..324 | 1..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32856-RB | 10..324 | 1..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32856-RA | 10..324 | 1..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32856-RA | 10..324 | 1..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32856-RA | 10..324 | 1..315 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32856-RA | 10..396 | 1..387 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32856-RB | 177..563 | 1..387 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32856-RA | 177..563 | 1..387 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32856-RA | 10..396 | 1..387 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32856-RA | 177..563 | 1..387 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15964735..15965019 | 103..387 | 100 | <- | Minus |
3R | 15965074..15965175 | 1..102 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15964735..15965019 | 103..387 | 100 | <- | Minus |
3R | 15965074..15965175 | 1..102 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15964735..15965019 | 103..387 | 100 | <- | Minus |
3R | 15965074..15965175 | 1..102 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 11790457..11790741 | 103..387 | 100 | <- | Minus |
arm_3R | 11790796..11790897 | 1..102 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15705566..15705850 | 103..387 | 100 | <- | Minus |
3R | 15705905..15706006 | 1..102 | 100 | Minus |
Translation from 0 to 314
> GM32296.pep TNRVLQKEQAELFAIQKKLDRVLPVIQEALNSLKVEELHLKSQVVGQQNP KTQCSPGRDPLHIDLSVEQSPITTVMESHLVNSQQIDLDLVSQMRRFEEE VDSD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16466-PA | 105 | GF16466-PA | 4..105 | 1..104 | 272 | 60.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20234-PA | 107 | GG20234-PA | 4..107 | 1..104 | 479 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13376-PA | 109 | GH13376-PA | 4..105 | 1..104 | 199 | 46.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32856-PB | 107 | CG32856-PB | 4..107 | 1..104 | 517 | 100 | Plus |
CG32856-PA | 107 | CG32856-PA | 4..107 | 1..104 | 517 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24635-PA | 101 | GI24635-PA | 4..101 | 1..104 | 188 | 50.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21721-PA | 102 | GL21721-PA | 4..102 | 1..104 | 184 | 51 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26380-PA | 102 | GA26380-PA | 4..102 | 1..104 | 193 | 49 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25740-PA | 107 | GM25740-PA | 4..107 | 1..104 | 513 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20314-PA | 107 | GD20314-PA | 4..107 | 1..104 | 506 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23457-PA | 103 | GJ23457-PA | 4..103 | 1..104 | 226 | 53.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11852-PA | 113 | GK11852-PA | 4..113 | 1..104 | 180 | 44.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26343-PA | 107 | GE26343-PA | 4..107 | 1..104 | 443 | 82.7 | Plus |
Translation from 0 to 314
> GM32296.hyp TNRVLQKEQAELFAIQKKLDRVLPVIQEALNSLKVEELHLKSQVVGQQNP KTQCSPGRDPLHIDLSVEQSPITTVMESHLVNSQQIDLDLVSQMRRFEEE VDSD*