Clone GM32296 Report

Search the DGRC for GM32296

Clone and Library Details

Library:GM
Tissue Source:Drosophila melanogaster ovary
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:322
Well:96
Vector:pOT2
Associated Gene/TranscriptCG32856-RA
Protein status:GM32296.pep: validated not full length
Sequenced Size:410

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32856 2002-10-15 Blastp of sequenced clone
CG32856 2008-04-29 Release 5.5 accounting
CG32856 2008-08-15 Release 5.9 accounting
CG32856 2008-12-18 5.12 accounting

Clone Sequence Records

GM32296.complete Sequence

410 bp (410 high quality bases) assembled on 2002-10-15

GenBank Submission: BT001467

> GM32296.complete
ACAAATCGAGTCCTTCAAAAAGAGCAGGCTGAACTATTTGCTATCCAGAA
GAAACTCGACCGAGTGCTCCCCGTCATTCAGGAGGCATTAAATTCACTAA
AGGTAGAGGAGCTGCATCTCAAGTCTCAGGTGGTGGGCCAGCAGAACCCA
AAAACGCAGTGCTCCCCTGGAAGGGATCCCCTCCACATAGATCTGTCGGT
GGAGCAGTCCCCAATCACAACTGTGATGGAGTCCCATCTCGTCAACAGCC
AGCAAATAGATCTGGATCTCGTAAGCCAAATGAGGCGTTTCGAGGAGGAA
GTCGACTCGGATTAAAATTGTTATTAAGGCTGGAACTTTACCAGAAAAAC
GTACATGTTGGGAGCATTAAAATATAAACAATACAGTAAAAAAAAAAAAA
AAAAAAAAAA

GM32296.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG32856-RA 650 CG32856-RA 207..594 1..388 1940 100 Plus
CG5516-RA 904 CG5516-RA 780..904 388..264 625 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11789333..11789619 387..101 1435 100 Minus
chr3R 27901430 chr3R 11789669..11789773 105..1 525 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:26:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15964734..15965021 388..101 1440 100 Minus
3R 32079331 3R 15965071..15965175 105..1 525 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15705565..15705852 388..101 1440 100 Minus
3R 31820162 3R 15705902..15706006 105..1 525 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:27:46 has no hits.

GM32296.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:28:48 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11789333..11789617 103..387 100 <- Minus
chr3R 11789672..11789773 1..102 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:10:44 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 10..324 1..315 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:57 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RB 10..324 1..315 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:15:35 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 10..324 1..315 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:05:03 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 10..324 1..315 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:51 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 10..324 1..315 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:40 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 10..396 1..387 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:57 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RB 177..563 1..387 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:15:35 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 177..563 1..387 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:05:04 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 10..396 1..387 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:51 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
CG32856-RA 177..563 1..387 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:28:48 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15964735..15965019 103..387 100 <- Minus
3R 15965074..15965175 1..102 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:28:48 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15964735..15965019 103..387 100 <- Minus
3R 15965074..15965175 1..102 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:28:48 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15964735..15965019 103..387 100 <- Minus
3R 15965074..15965175 1..102 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:15:35 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11790457..11790741 103..387 100 <- Minus
arm_3R 11790796..11790897 1..102 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:06 Download gff for GM32296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15705566..15705850 103..387 100 <- Minus
3R 15705905..15706006 1..102 100   Minus

GM32296.pep Sequence

Translation from 0 to 314

> GM32296.pep
TNRVLQKEQAELFAIQKKLDRVLPVIQEALNSLKVEELHLKSQVVGQQNP
KTQCSPGRDPLHIDLSVEQSPITTVMESHLVNSQQIDLDLVSQMRRFEEE
VDSD*

GM32296.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16466-PA 105 GF16466-PA 4..105 1..104 272 60.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20234-PA 107 GG20234-PA 4..107 1..104 479 88.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13376-PA 109 GH13376-PA 4..105 1..104 199 46.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32856-PB 107 CG32856-PB 4..107 1..104 517 100 Plus
CG32856-PA 107 CG32856-PA 4..107 1..104 517 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24635-PA 101 GI24635-PA 4..101 1..104 188 50.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21721-PA 102 GL21721-PA 4..102 1..104 184 51 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26380-PA 102 GA26380-PA 4..102 1..104 193 49 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25740-PA 107 GM25740-PA 4..107 1..104 513 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20314-PA 107 GD20314-PA 4..107 1..104 506 95.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23457-PA 103 GJ23457-PA 4..103 1..104 226 53.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11852-PA 113 GK11852-PA 4..113 1..104 180 44.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26343-PA 107 GE26343-PA 4..107 1..104 443 82.7 Plus

GM32296.hyp Sequence

Translation from 0 to 314

> GM32296.hyp
TNRVLQKEQAELFAIQKKLDRVLPVIQEALNSLKVEELHLKSQVVGQQNP
KTQCSPGRDPLHIDLSVEQSPITTVMESHLVNSQQIDLDLVSQMRRFEEE
VDSD*

GM32296.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32856-PB 107 CG32856-PB 4..107 1..104 517 100 Plus
CG32856-PA 107 CG32856-PA 4..107 1..104 517 100 Plus