Clone HL01112 Report

Search the DGRC for HL01112

Clone and Library Details

Library:HL
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:11
Well:12
Vector:pBS SK-
Associated Gene/TranscripteIF2B-alpha-RA
Protein status:HL01112.pep: gold
Preliminary Size:1174
Sequenced Size:999

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7883 2001-01-01 Release 2 assignment
CG7883 2001-10-10 Blastp of sequenced clone
CG7883 2003-01-01 Sim4 clustering to Release 3
eIF2B-alpha 2008-04-29 Release 5.5 accounting
eIF2B-alpha 2008-08-15 Release 5.9 accounting
eIF2B-alpha 2008-12-18 5.12 accounting

Clone Sequence Records

HL01112.complete Sequence

999 bp (999 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060991

> HL01112.complete
AACGTGCAGCGGTAGGCTTTCACAATTTCATAAAAATGCCGCAAATTACG
GAAAATGGCCAGGATTTTGATGTGGTCAAATACTTCCTGCAGCTCCTGGA
CGAGGACAAGGATCTGTCCTCCGGCATTGCGGCTATCAGGACTCTGCTAA
TGATCCTGGAAAAGAAACAATTTGGAACCATTCATATTCTACACACAACC
ATGAGGGAAGCGGTGGCTGCCATGCGGAATACGGATTTGTCTATAGCAGC
CATTGTTTCTGCCGGAGAGCTCTTTTGCAGGTTCATCACCCTCAGTCTGG
ACGACAAGCACATGGAGGAGTGCCGGCAGATTATGTTGAATCGCGGAAAA
ATCTTCCTCACCAAGTTGCTCAATTCCCGGCAGGTGATTGCCCAGCAGGC
CCAAAGGTTCATTACCGATGGCTGCCGTATATTGACGCACTCCCGATCCC
GGGTGGTCCTCAAGGCGCTGATTACAGCCTCGCAGAACAAAAAGTCCTTC
CACGTTTATGTGACGCAGGGCGGCACGGGAAACTCTGGCGAAGAGATGGT
TAAGGATCTGCATGCGGCCGGCATCGATTGCACGCTCATTCTGGACTCAG
CCACCGGCTATGTTATGGAATCGGTGGACTTTGTGCTTGTGGGGGCTGAA
GCCGTGGTGGAGAGTGGTGGCATTATCAACCGCATTGGCACCTACACCAT
GGGTCTGTGCGCCCGTGAGATGAAGAAACCTTTCTACGTTCTGGCCGAAA
GCTTCAAGTTCAGCCGTCTGTATCCACTCAATCAGCGCGATCTGCCAAAC
GAGTACAAGTACTCCCGCAAACACCTAAACGATGTAAGCAAAGTGCACCC
GCTGGTCGACTATACGCCACCCGTCTACATCACCCTGCTCTTCACCGACC
TCGGAAGACTAACACCCTCGGCCGTAAGCGACGAGTTGATCAAACTCTAC
ATGTAAGGGCGAATAAAGATATTGCACTTAAAAAAAAAAAAAAAAAAAA

HL01112.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
eIF2B-alpha-RA 1036 eIF2B-alpha-RA 49..1030 1..982 4910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25757242..25757513 809..538 1345 99.6 Minus
chr3R 27901430 chr3R 25757788..25758001 385..172 1055 99.5 Minus
chr3R 27901430 chr3R 25757013..25757184 979..808 845 99.4 Minus
chr3R 27901430 chr3R 25757568..25757725 538..381 790 100 Minus
chr3R 27901430 chr3R 25758063..25758165 171..69 500 99 Minus
chr3R 27901430 chr3R 25758224..25758292 69..1 330 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:26:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29934811..29935082 809..538 1360 100 Minus
3R 32079331 3R 29935357..29935570 385..172 1070 100 Minus
3R 32079331 3R 29934579..29934753 982..808 875 100 Minus
3R 32079331 3R 29935137..29935294 538..381 790 100 Minus
3R 32079331 3R 29935633..29935735 171..69 515 100 Minus
3R 32079331 3R 29935794..29935862 69..1 345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29675642..29675913 809..538 1360 100 Minus
3R 31820162 3R 29676188..29676401 385..172 1070 100 Minus
3R 31820162 3R 29675410..29675584 982..808 875 100 Minus
3R 31820162 3R 29675968..29676125 538..381 790 100 Minus
3R 31820162 3R 29676464..29676566 171..69 515 100 Minus
3R 31820162 3R 29676625..29676693 69..1 345 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:47:41 has no hits.

HL01112.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:48:28 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25757013..25757182 810..979 99 <- Minus
chr3R 25757242..25757512 539..809 99 <- Minus
chr3R 25757568..25757722 384..538 100 <- Minus
chr3R 25757790..25758001 172..383 99 <- Minus
chr3R 25758063..25758164 70..171 99 <- Minus
chr3R 25758224..25758292 1..69 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:11:02 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
eIF2B-alpha-RA 1..921 36..956 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:18 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
eIF2B-alpha-RA 1..921 36..956 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:28:08 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
eIF2B-alpha-RA 1..921 36..956 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:00 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
eIF2B-alpha-RA 1..921 36..956 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:27:06 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
eIF2B-alpha-RA 1..921 36..956 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:16 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
eIF2B-alpha-RA 15..993 1..979 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:17 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
eIF2B-alpha-RA 15..993 1..979 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:28:08 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
eIF2B-alpha-RA 27..1005 1..979 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:00 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
eIF2B-alpha-RA 15..993 1..979 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:27:06 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
eIF2B-alpha-RA 27..1005 1..979 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:48:28 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29934582..29934751 810..979 100 <- Minus
3R 29934811..29935081 539..809 100 <- Minus
3R 29935137..29935291 384..538 100 <- Minus
3R 29935359..29935570 172..383 100 <- Minus
3R 29935633..29935734 70..171 100 <- Minus
3R 29935794..29935862 1..69 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:48:28 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29934582..29934751 810..979 100 <- Minus
3R 29934811..29935081 539..809 100 <- Minus
3R 29935137..29935291 384..538 100 <- Minus
3R 29935359..29935570 172..383 100 <- Minus
3R 29935633..29935734 70..171 100 <- Minus
3R 29935794..29935862 1..69 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:48:28 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29934582..29934751 810..979 100 <- Minus
3R 29934811..29935081 539..809 100 <- Minus
3R 29935137..29935291 384..538 100 <- Minus
3R 29935359..29935570 172..383 100 <- Minus
3R 29935633..29935734 70..171 100 <- Minus
3R 29935794..29935862 1..69 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:28:08 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25760304..25760473 810..979 100 <- Minus
arm_3R 25760859..25761013 384..538 100 <- Minus
arm_3R 25760533..25760803 539..809 100 <- Minus
arm_3R 25761081..25761292 172..383 100 <- Minus
arm_3R 25761355..25761456 70..171 100 <- Minus
arm_3R 25761516..25761584 1..69 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:53:57 Download gff for HL01112.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29675642..29675912 539..809 100 <- Minus
3R 29675968..29676122 384..538 100 <- Minus
3R 29676190..29676401 172..383 100 <- Minus
3R 29676464..29676565 70..171 100 <- Minus
3R 29676625..29676693 1..69 100   Minus
3R 29675413..29675582 810..979 100 <- Minus

HL01112.hyp Sequence

Translation from 2 to 955

> HL01112.hyp
RAAVGFHNFIKMPQITENGQDFDVVKYFLQLLDEDKDLSSGIAAIRTLLM
ILEKKQFGTIHILHTTMREAVAAMRNTDLSIAAIVSAGELFCRFITLSLD
DKHMEECRQIMLNRGKIFLTKLLNSRQVIAQQAQRFITDGCRILTHSRSR
VVLKALITASQNKKSFHVYVTQGGTGNSGEEMVKDLHAAGIDCTLILDSA
TGYVMESVDFVLVGAEAVVESGGIINRIGTYTMGLCAREMKKPFYVLAES
FKFSRLYPLNQRDLPNEYKYSRKHLNDVSKVHPLVDYTPPVYITLLFTDL
GRLTPSAVSDELIKLYM*

HL01112.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
eIF2B-alpha-PA 306 CG7883-PA 1..306 12..317 1551 100 Plus
eIF2B-delta-PD 576 CG10315-PD 299..564 54..308 211 26.9 Plus
eIF2B-delta-PB 576 CG10315-PB 299..564 54..308 211 26.9 Plus
eIF2B-delta-PC 576 CG10315-PC 299..564 54..308 211 26.9 Plus
eIF2B-delta-PA 626 CG10315-PA 349..614 54..308 211 26.9 Plus

HL01112.pep Sequence

Translation from 35 to 955

> HL01112.pep
MPQITENGQDFDVVKYFLQLLDEDKDLSSGIAAIRTLLMILEKKQFGTIH
ILHTTMREAVAAMRNTDLSIAAIVSAGELFCRFITLSLDDKHMEECRQIM
LNRGKIFLTKLLNSRQVIAQQAQRFITDGCRILTHSRSRVVLKALITASQ
NKKSFHVYVTQGGTGNSGEEMVKDLHAAGIDCTLILDSATGYVMESVDFV
LVGAEAVVESGGIINRIGTYTMGLCAREMKKPFYVLAESFKFSRLYPLNQ
RDLPNEYKYSRKHLNDVSKVHPLVDYTPPVYITLLFTDLGRLTPSAVSDE
LIKLYM*

HL01112.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16217-PA 306 GF16217-PA 1..306 1..306 1551 94.8 Plus
Dana\GF13053-PA 655 GF13053-PA 450..643 116..297 214 33.5 Plus
Dana\GF22448-PA 352 GF22448-PA 130..345 97..305 184 27.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11983-PA 306 GG11983-PA 1..306 1..306 1633 100 Plus
Dere\GG22851-PA 630 GG22851-PA 425..618 116..297 200 31.4 Plus
Dere\GG18621-PA 352 GG18621-PA 130..345 97..305 190 28.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22202-PA 306 GH22202-PA 1..306 1..306 1541 92.8 Plus
Dgri\GH21224-PA 642 GH21224-PA 437..630 116..297 200 31.4 Plus
Dgri\GH12777-PA 352 GH12777-PA 101..345 65..305 184 26.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
eIF2Balpha-PA 306 CG7883-PA 1..306 1..306 1551 100 Plus
eIF2Bdelta-PD 576 CG10315-PD 299..564 43..297 211 26.9 Plus
eIF2Bdelta-PB 576 CG10315-PB 299..564 43..297 211 26.9 Plus
eIF2Bdelta-PC 576 CG10315-PC 299..564 43..297 211 26.9 Plus
eIF2Bdelta-PA 626 CG10315-PA 349..614 43..297 211 26.9 Plus
eIF2Bbeta-PA 352 CG2677-PA 130..345 97..305 180 27.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21971-PA 306 GI21971-PA 1..306 1..306 1525 91.2 Plus
Dmoj\GI20509-PA 643 GI20509-PA 438..631 116..297 204 31.4 Plus
Dmoj\GI15870-PA 352 GI15870-PA 130..345 97..305 163 26.3 Plus
Dmoj\GI10562-PA 362 GI10562-PA 97..359 74..304 153 27.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13494-PA 306 GL13494-PA 1..306 1..306 1533 93.5 Plus
Dper\GL16909-PA 632 GL16909-PA 427..620 116..297 204 32.5 Plus
Dper\GL19913-PA 352 GL19913-PA 130..345 97..305 186 28.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20657-PA 306 GA20657-PA 1..306 1..306 1533 93.5 Plus
Dpse\GA10239-PA 572 GA10239-PA 367..560 116..297 204 32.5 Plus
Dpse\GA15423-PA 352 GA15423-PA 130..345 97..305 186 28.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12201-PA 306 GM12201-PA 1..306 1..306 1628 99.7 Plus
Dsec\GM16009-PA 630 GM16009-PA 432..618 123..297 201 31.6 Plus
Dsec\GM19241-PA 352 GM19241-PA 130..345 97..305 184 27.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17524-PA 306 GD17524-PA 1..306 1..306 1628 99.7 Plus
Dsim\GD11760-PA 630 GD11760-PA 432..618 123..297 202 31.6 Plus
Dsim\GD16616-PA 352 GD16616-PA 130..345 97..305 184 27.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14332-PA 306 GJ14332-PA 1..306 1..306 1503 90.2 Plus
Dvir\GJ22361-PA 593 GJ22361-PA 357..581 86..297 198 29.4 Plus
Dvir\GJ18516-PA 352 GJ18516-PA 130..345 97..305 192 28.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14086-PA 306 GK14086-PA 1..306 1..306 1521 92.5 Plus
Dwil\GK23180-PA 598 GK23180-PA 321..586 43..297 189 28 Plus
Dwil\GK19802-PA 352 GK19802-PA 130..345 97..305 184 27.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10409-PA 306 GE10409-PA 1..306 1..306 1632 99.7 Plus
Dyak\GE14287-PA 636 GE14287-PA 438..624 123..297 199 31.6 Plus
Dyak\GE16274-PA 352 GE16274-PA 130..345 97..305 184 28.1 Plus