Clone HL02087 Report

Search the DGRC for HL02087

Clone and Library Details

Library:HL
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:20
Well:87
Vector:pBS SK-
Associated Gene/TranscriptCG6329-RB
Protein status:HL02087.pep: gold
Preliminary Size:1258
Sequenced Size:1102

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6329 2001-01-01 Release 2 assignment
CG6329 2001-11-09 Blastp of sequenced clone
CG6329 2003-01-01 Sim4 clustering to Release 3
CG6329 2008-04-29 Release 5.5 accounting
CG6329 2008-08-15 Release 5.9 accounting
CG6329 2008-12-18 5.12 accounting

Clone Sequence Records

HL02087.complete Sequence

1102 bp (1102 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069299

> HL02087.complete
CCGCGTCGCGTGACCGCATCAGAGTCCACAGCAAATCAGGAGGCCCTTGG
CACACAAAATCGAGCATTTGAAGTACGAATTCGAGAGTTTTTTTTAGCGA
GCGCAAAGGCTAATATGCTGATATAGCATCGTATCAGCATCAGCACGCAA
ATTGTCCAACGAAGGGAACTCGTCACCGAAACAAATTGTTGCTCCAGCCG
CCGGGCAGAGAAGAAGTGAAAACATAAGCTCAAAAAGCAAATAAAACTAA
TTGAAATAAATCCAAATACATACAAAATGTCGCCGTTCATGGAGAAGACG
TTGTTGTTGTTAGGCGTGCTCTGCTGCATACAAGTGACCACTGCCCTGAT
GTGCTACGACTGCAACAGCGAGTTCGATCCCCGCTGCGGCGATCCCTTCG
AGCCGTACTCCATTGGCGAGGTGAACTGCAGCAAACAGGAGCCTCTGGAG
CATCTGAAGGACAAATACAAGCCCACCCTGTGCCGCAAAACCGTGCAAAA
GATTTACGGGAAGACCCGGATTGTGCGTGGATGCGGATACATCCCAGACG
AAAACACCGACAACAAGTGCGTGAGACGCTCGGGAACCCACGACGTGGCC
GCCATCTACTGCTCCTGCACCAAGGATCTGTGCAACGGGGCCAACTCGCC
TGCTGGCCAGTGGATGATGCTGCCCCTCATTGTGGCCGCCGGATTGGCGC
TCCTGCTGAACTCGAGGCACACAATACGATTCCAGAGCTCGTAAATTGGG
CTCGAATTAGCGTTTCATTGCGTTCAACTGTACTTATCGTTTTTGAGTTT
GTTTTCAATGGTTTTTCGATTCAGTTCTGCAGTTGATGCTCATTTAGTTG
CATAATTTACTTTAATATATCATTTAATGTGTTCGTAAGCGTAAATTGAA
TAAGAATAATACGGAAATTAACTTACCTTATGCGTTCGCATGCATTATAT
AAATCAAACAGGATAAAATCGAAAAAGGTAACACACACTCTCTTGGGGGC
AGTAATAAAATAATAACCTTTTTTAAGCCTTTGTTCGAAATTAATTTTAA
AATACAGAAAAACTGCCAGTAAATGTCTCCGCCTAAAAAAAAAAAAAAAA
AA

HL02087.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG6329.g 3275 CG6329.g 47..1141 1..1095 5475 100 Plus
CG6329.i 2185 CG6329.i 47..1141 1..1095 5475 100 Plus
CG6329-RC 1146 CG6329-RC 47..1141 1..1095 5475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9718119..9718700 503..1084 2910 100 Plus
chr2R 21145070 chr2R 9716979..9717206 107..334 1140 100 Plus
chr2R 21145070 chr2R 9717890..9718059 333..502 820 98.8 Plus
chr2R 21145070 chr2R 9713720..9713828 1..109 545 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:27:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13830778..13831370 503..1095 2965 100 Plus
2R 25286936 2R 13829638..13829865 107..334 1140 100 Plus
2R 25286936 2R 13830549..13830718 333..502 850 100 Plus
2R 25286936 2R 13826410..13826518 1..109 545 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13831977..13832569 503..1095 2965 100 Plus
2R 25260384 2R 13830837..13831064 107..334 1140 100 Plus
2R 25260384 2R 13831748..13831917 333..502 850 100 Plus
2R 25260384 2R 13827609..13827717 1..109 545 100 Plus
Blast to na_te.dros performed 2019-03-16 18:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 1100..1284 1084..899 162 57.9 Minus
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 2208..2277 573..644 111 65.3 Plus

HL02087.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:42:42 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9713720..9713827 1..108 100 -> Plus
chr2R 9716981..9717206 109..334 100 -> Plus
chr2R 9717892..9718059 335..502 98 -> Plus
chr2R 9718119..9718700 503..1084 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:11:46 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
CG6329-RB 1..468 277..744 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:30:44 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
CG6329-RB 1..468 277..744 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:23 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
CG6329-RD 1..468 277..744 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:58:23 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
CG6329-RB 1..468 277..744 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:47:18 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
CG6329-RD 1..468 277..744 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:08:51 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
CG6329-RC 1..1084 1..1084 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:30:43 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
CG6329-RC 1..1084 1..1084 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:23 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
CG6329-RC 40..1123 1..1084 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:58:23 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
CG6329-RC 1..1084 1..1084 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:47:18 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
CG6329-RC 40..1123 1..1084 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:42 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13826410..13826517 1..108 100 -> Plus
2R 13829640..13829865 109..334 100 -> Plus
2R 13830551..13830718 335..502 100 -> Plus
2R 13830778..13831359 503..1084 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:42 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13826410..13826517 1..108 100 -> Plus
2R 13829640..13829865 109..334 100 -> Plus
2R 13830551..13830718 335..502 100 -> Plus
2R 13830778..13831359 503..1084 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:42 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13826410..13826517 1..108 100 -> Plus
2R 13829640..13829865 109..334 100 -> Plus
2R 13830551..13830718 335..502 100 -> Plus
2R 13830778..13831359 503..1084 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:23 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9713915..9714022 1..108 100 -> Plus
arm_2R 9717145..9717370 109..334 100 -> Plus
arm_2R 9718056..9718223 335..502 100 -> Plus
arm_2R 9718283..9718864 503..1084 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:34:46 Download gff for HL02087.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13830839..13831064 109..334 100 -> Plus
2R 13831750..13831917 335..502 100 -> Plus
2R 13831977..13832558 503..1084 100   Plus
2R 13827609..13827716 1..108 100 -> Plus

HL02087.hyp Sequence

Translation from 276 to 743

> HL02087.hyp
MSPFMEKTLLLLGVLCCIQVTTALMCYDCNSEFDPRCGDPFEPYSIGEVN
CSKQEPLEHLKDKYKPTLCRKTVQKIYGKTRIVRGCGYIPDENTDNKCVR
RSGTHDVAAIYCSCTKDLCNGANSPAGQWMMLPLIVAAGLALLLNSRHTI
RFQSS*

HL02087.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG6329-PF 155 CG6329-PF 1..155 1..155 847 100 Plus
CG6329-PE 155 CG6329-PE 1..155 1..155 847 100 Plus
CG6329-PD 155 CG6329-PD 1..155 1..155 847 100 Plus
CG6329-PB 155 CG6329-PB 1..155 1..155 847 100 Plus
CG6329-PC 155 CG6329-PC 1..155 1..155 847 100 Plus

HL02087.pep Sequence

Translation from 276 to 743

> HL02087.pep
MSPFMEKTLLLLGVLCCIQVTTALMCYDCNSEFDPRCGDPFEPYSIGEVN
CSKQEPLEHLKDKYKPTLCRKTVQKIYGKTRIVRGCGYIPDENTDNKCVR
RSGTHDVAAIYCSCTKDLCNGANSPAGQWMMLPLIVAAGLALLLNSRHTI
RFQSS*

HL02087.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13713-PA 155 GF13713-PA 1..155 1..155 773 89.7 Plus
Dana\GF14191-PA 151 GF14191-PA 4..133 5..130 251 38.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20404-PA 155 GG20404-PA 1..155 1..155 820 98.1 Plus
Dere\GG23775-PA 151 GG23775-PA 4..126 5..123 220 36.3 Plus
Dere\GG21259-PA 159 GG21259-PA 23..133 20..123 141 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21037-PA 155 GH21037-PA 1..155 1..155 664 79.5 Plus
Dgri\GH11641-PA 151 GH11641-PA 1..125 1..122 232 34.1 Plus
Dgri\GH10589-PA 155 GH10589-PA 25..139 13..130 145 34.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG6329-PF 155 CG6329-PF 1..155 1..155 847 100 Plus
CG6329-PE 155 CG6329-PE 1..155 1..155 847 100 Plus
CG6329-PD 155 CG6329-PD 1..155 1..155 847 100 Plus
CG6329-PB 155 CG6329-PB 1..155 1..155 847 100 Plus
CG6329-PC 155 CG6329-PC 1..155 1..155 847 100 Plus
CG6329-PA 155 CG6329-PA 1..155 1..155 847 100 Plus
crok-PA 151 CG17218-PA 4..125 5..122 255 39.8 Plus
CG31676-PB 159 CG31676-PB 9..150 10..138 176 33.8 Plus
CG31676-PA 159 CG31676-PA 9..150 10..138 176 33.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18639-PA 154 GI18639-PA 1..154 1..155 648 76.8 Plus
Dmoj\GI17943-PA 151 GI17943-PA 4..125 5..122 244 39.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17476-PA 155 GL17476-PA 1..155 1..155 609 87.1 Plus
Dper\GL18618-PA 151 GL18618-PA 4..128 5..125 240 39.7 Plus
Dper\GL18525-PA 157 GL18525-PA 1..133 1..122 144 30.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19515-PA 155 GA19515-PA 1..155 1..155 609 87.1 Plus
Dpse\GA14397-PA 151 GA14397-PA 4..128 5..125 240 39.7 Plus
Dpse\GA25671-PA 157 GA25671-PA 1..133 1..122 144 30.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21492-PA 155 GM21492-PA 1..155 1..155 828 99.4 Plus
Dsec\GM26756-PA 128 GM26756-PA 17..103 43..123 144 36.4 Plus
Dsec\GM23383-PA 148 GM23383-PA 1..147 5..144 135 30.6 Plus
Dsec\GM23377-PA 167 GM23377-PA 23..133 20..123 135 32.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10986-PA 155 GD10986-PA 1..155 1..155 832 100 Plus
Dsim\GD23827-PA 151 GD23827-PA 4..126 5..123 242 39.5 Plus
Dsim\GD24292-PA 148 GD24292-PA 1..147 5..144 135 30.6 Plus
Dsim\GD24287-PA 159 GD24287-PA 23..133 20..123 134 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21652-PA 154 GJ21652-PA 1..154 1..155 662 79.4 Plus
Dvir\GJ17714-PA 151 GJ17714-PA 4..126 5..123 240 39.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17859-PA 150 GK17859-PA 1..148 1..150 558 78 Plus
Dwil\GK15491-PA 151 GK15491-PA 4..145 5..141 239 35.7 Plus
Dwil\GK15439-PA 159 GK15439-PA 28..139 13..126 137 33.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12564-PA 157 GE12564-PA 1..157 1..155 802 96.8 Plus
Dyak\GE18579-PA 151 GE18579-PA 4..126 5..123 239 39.5 Plus
Dyak\GE12881-PA 159 GE12881-PA 23..133 20..123 134 32.5 Plus