Clone HL02449 Report

Search the DGRC for HL02449

Clone and Library Details

Library:HL
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:24
Well:49
Vector:pBS SK-
Associated Gene/TranscriptCheA75a-RA
Protein status:HL02449.pep: Inserted from web
Preliminary Size:940
Sequenced Size:710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7313 2001-01-01 Release 2 assignment
CG7313 2002-05-17 Blastp of sequenced clone
CG7313 2003-01-01 Sim4 clustering to Release 3
CheA75a 2008-04-29 Release 5.5 accounting
CheA75a 2008-08-15 Release 5.9 accounting
CheA75a 2008-12-18 5.12 accounting

Clone Sequence Records

HL02449.complete Sequence

710 bp (710 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118483.1

> HL02449.complete
TAGTGATAATAGTACTCCTCCAACTGCTGGAAAAAATAAAGTGCGAGCAG
TCCTATGAGGTTACCAATGAAAGGTTGGAGCCTTTCGAGGGCGATTCACA
AACTTTAGTGCTCTTCGATGGACTGAAAACGATTGGCCGGGAGAGAGCTC
TTAACGGATCCTTCAAATTCCTCGGTGAGATGAACAATGATGACTTCAAG
GTATCCGTGGAGCTCTATTCAAGCCCCAATGGCGATGGGGAATTCAAGAG
GATGGTCATGGATGTGCCGCAAACTAGCATTTGCGAGTGCTTCAAAAAGT
TCTATGTCCAGTTTGTGCAACCCTCTCTGAAGACTGGAGAAACCACAAAT
TTCCCCGTTGTCGACGATGACTTTTGCCCAGTGCCCGAAGGCGAATTCTA
CGTTAAGAACGTCATTTTGAATACGCAAGATTGGCCATCGCAGGTGCCTC
GAGGGATTGTCAAGGCCATTATAACATTCTTCAGTGGTGGCAAAAATGTT
GGCGGCCTAATTGTAGAAGTCAAAATTGAAGATCGACAAAGTTAGAGTCA
TGGCAGCAATGCAAATTTTGTGAGAATCGTCACAACGAACAGTTTTTAGT
ATTCATGAAAGTAATAGAATGTAGTTTAAATGTTTTACACAATATTCTAT
ATATTCTATAACAAAATAAATGTCTTTGAACGTTGAACGAAAAAAAAAAA
AAAAAAAAAA

HL02449.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
CheA75a-RA 842 CheA75a-RA 150..841 1..692 3460 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18241843..18242492 40..689 3175 99.2 Plus
chr3L 24539361 chr3L 18241744..18241784 1..41 190 97.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:27:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18252197..18252849 40..692 3265 100 Plus
3L 28110227 3L 18252098..18252138 1..41 205 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18245297..18245949 40..692 3265 100 Plus
3L 28103327 3L 18245198..18245238 1..41 205 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:01:28 has no hits.

HL02449.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:02:39 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18241744..18241784 1..41 97 -> Plus
chr3L 18241845..18242492 42..689 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:11:54 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 11..555 1..545 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:49:11 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 11..555 1..545 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:25:25 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 11..555 1..545 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:41:45 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 11..555 1..545 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:08 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 11..555 1..545 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:26:07 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 11..699 1..689 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:49:11 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 11..699 1..689 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:25:25 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 11..699 1..689 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:41:45 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 11..699 1..689 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:08 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
CheA75a-RA 11..699 1..689 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:39 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18252098..18252138 1..41 100 -> Plus
3L 18252199..18252846 42..689 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:39 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18252098..18252138 1..41 100 -> Plus
3L 18252199..18252846 42..689 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:39 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18252098..18252138 1..41 100 -> Plus
3L 18252199..18252846 42..689 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:25:25 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18245198..18245238 1..41 100 -> Plus
arm_3L 18245299..18245946 42..689 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:14:03 Download gff for HL02449.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18245299..18245946 42..689 100   Plus
3L 18245198..18245238 1..41 100 -> Plus

HL02449.pep Sequence

Translation from 2 to 544

> HL02449.pep
VIIVLLQLLEKIKCEQSYEVTNERLEPFEGDSQTLVLFDGLKTIGRERAL
NGSFKFLGEMNNDDFKVSVELYSSPNGDGEFKRMVMDVPQTSICECFKKF
YVQFVQPSLKTGETTNFPVVDDDFCPVPEGEFYVKNVILNTQDWPSQVPR
GIVKAIITFFSGGKNVGGLIVEVKIEDRQS*

HL02449.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23621-PA 375 GF23621-PA 17..183 13..179 815 87.4 Plus
Dana\GF20005-PA 157 GF20005-PA 4..154 16..177 242 37.7 Plus
Dana\GF19868-PA 119 GF19868-PA 1..119 60..180 219 32.2 Plus
Dana\GF16169-PA 163 GF16169-PA 1..108 60..169 176 32.7 Plus
Dana\GF19770-PA 97 GF19770-PA 1..95 84..178 169 31.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13658-PA 184 GG13658-PA 5..184 1..180 897 94.4 Plus
Dere\GG17246-PA 186 GG17246-PA 42..181 38..179 235 31 Plus
Dere\GG17472-PA 179 GG17472-PA 44..177 41..177 232 35 Plus
Dere\GG21914-PA 178 GG21914-PA 21..173 15..175 204 28 Plus
Dere\GG25287-PA 181 GG25287-PA 33..180 23..179 188 32.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22250-PA 184 GH22250-PA 5..184 1..180 752 76.7 Plus
Dgri\GH14453-PA 184 GH14453-PA 5..184 1..180 742 75.6 Plus
Dgri\GH21868-PA 157 GH21868-PA 2..153 24..176 265 29.4 Plus
Dgri\GH21867-PA 154 GH21867-PA 1..154 25..179 258 30.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
CheA75a-PA 184 CG7313-PA 5..184 1..180 938 100 Plus
CheA86a-PA 189 CG33698-PA 6..180 2..178 270 33 Plus
CheA84a-PA 180 CG33779-PA 8..178 4..177 260 32.2 Plus
CheA56a-PA 180 CG33724-PA 22..177 15..177 219 28.8 Plus
CheA29a-PA 180 CG33194-PA 32..177 23..177 165 27.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13589-PA 184 GI13589-PA 5..184 1..180 754 74.4 Plus
Dmoj\GI20369-PA 188 GI20369-PA 35..186 26..178 261 30.1 Plus
Dmoj\GI20367-PA 187 GI20367-PA 27..187 18..179 255 27.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22869-PA 184 GL22869-PA 14..184 10..180 783 83.6 Plus
Dper\GL23277-PA 316 GL23277-PA 127..315 5..178 278 33.2 Plus
Dper\GL11669-PA 141 GL11669-PA 5..125 40..169 209 35.4 Plus
Dper\GL17155-PA 147 GL17155-PA 1..147 25..180 190 30.8 Plus
Dper\GL17088-PA 113 GL17088-PA 16..113 78..180 167 34 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20253-PA 184 GA20253-PA 14..184 10..180 783 83.6 Plus
Dpse\GA27206-PB 308 GA27206-PB 172..308 41..179 277 37.4 Plus
Dpse\GA25606-PB 176 GA25606-PB 9..174 3..178 208 31.8 Plus
Dpse\GA16964-PA 506 GA16964-PA 365..490 38..169 195 34.1 Plus
Dpse\GA24359-PA 113 GA24359-PA 16..113 78..180 167 34 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14971-PA 184 GM14971-PA 5..184 1..180 922 97.8 Plus
Dsec\GM26365-PA 180 GM26365-PA 8..178 4..177 260 32.8 Plus
Dsec\GM26132-PA 185 GM26132-PA 42..180 38..178 259 36.2 Plus
Dsec\GM21905-PA 179 GM21905-PA 22..176 15..177 214 29.4 Plus
Dsec\GM16968-PA 180 GM16968-PA 32..179 23..179 181 29.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20888-PA 180 GD20888-PA 41..178 38..177 265 37.1 Plus
Dsim\GD15112-PA 185 GD15112-PA 6..180 2..178 260 32.4 Plus
Dsim\GD23770-PA 161 GD23770-PA 25..160 41..178 233 31.9 Plus
Dsim\GD11401-PA 179 GD11401-PA 22..176 15..177 206 29.4 Plus
Dsim\GD23547-PA 180 GD23547-PA 32..179 23..179 178 28 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13928-PA 183 GJ13928-PA 5..183 1..179 719 72.6 Plus
Dvir\GJ22094-PA 165 GJ22094-PA 4..163 18..178 303 34.8 Plus
Dvir\GJ22095-PA 188 GJ22095-PA 33..184 24..176 237 29.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11605-PA 185 GK11605-PA 6..185 1..180 818 84.4 Plus
Dwil\GK18986-PA 167 GK18986-PA 10..163 24..176 274 34.8 Plus
Dwil\GK23998-PA 167 GK23998-PA 29..165 41..178 272 36.2 Plus
Dwil\GK18985-PA 165 GK18985-PA 3..161 16..176 262 31.7 Plus
Dwil\GK20686-PA 180 GK20686-PA 21..178 15..178 243 32.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19953-PA 184 GE19953-PA 5..184 1..180 905 95.6 Plus
Dyak\GE24649-PA 187 GE24649-PA 5..180 1..178 264 32.8 Plus
Dyak\GE24871-PA 180 GE24871-PA 45..178 41..177 263 38.7 Plus
Dyak\GE11988-PA 178 GE11988-PA 21..175 15..177 205 28.8 Plus

HL02449.hyp Sequence

Translation from 2 to 544

> HL02449.hyp
VIIVLLQLLEKIKCEQSYEVTNERLEPFEGDSQTLVLFDGLKTIGRERAL
NGSFKFLGEMNNDDFKVSVELYSSPNGDGEFKRMVMDVPQTSICECFKKF
YVQFVQPSLKTGETTNFPVVDDDFCPVPEGEFYVKNVILNTQDWPSQVPR
GIVKAIITFFSGGKNVGGLIVEVKIEDRQS*

HL02449.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
CheA75a-PA 184 CG7313-PA 5..184 1..180 938 100 Plus
CheA86a-PA 189 CG33698-PA 6..180 2..178 270 33 Plus
CheA84a-PA 180 CG33779-PA 8..178 4..177 260 32.2 Plus
CheA56a-PA 180 CG33724-PA 22..177 15..177 219 28.8 Plus
CheA29a-PA 180 CG33194-PA 32..177 23..177 165 27.1 Plus