Clone HL07956 Report

Search the DGRC for HL07956

Clone and Library Details

Library:HL
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:79
Well:56
Vector:pOT2
Associated Gene/TranscriptmRpL18-RA
Protein status:HL07956.pep: gold
Preliminary Size:716
Sequenced Size:797

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12373 2002-01-01 Sim4 clustering to Release 2
CG12373 2002-05-18 Blastp of sequenced clone
CG12373 2003-01-01 Sim4 clustering to Release 3
mRpL18 2008-04-29 Release 5.5 accounting
mRpL18 2008-08-15 Release 5.9 accounting
mRpL18 2008-12-18 5.12 accounting

Clone Sequence Records

HL07956.complete Sequence

797 bp (797 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118885

> HL07956.complete
TTTGGACATTTTACAGCACCAATAAATCGTTTACCCACACTCAGTTCTGG
CAGTCTGGTAACACTAAAGGCAGCTCAAAATATTTTATCGTGGTTTTGTA
ATTTCCACATAAATATCAATTAAACGCGCGCTTTTTTCGGGTTTCCATCG
CAAAAATGTCTCGCAGTGCTCGCCCCCTCACCTCCGCCCGTGTACTGCAC
AAAATCAAGGAATTAACAACCCCGCAAGCCAGCACTGAATACGTGATCAA
CCGGAATCCACGGAACTTGGAAAGATTACGCATTGCCTACAAGCCGGTAG
GCTATCATCTGGAGAAACCAGGTCGTTCCTACTGGCACACTTTGGAAATC
AACACCAGCGGCCGCTATGTCAGCGGCGATGTCAAGCACTTTGAGAATGG
AACCATCCTGAGTGCCAGCACCTCGGAATGGGCCATTAAACAGCAGTTGT
ACAAGACCAACGACACATCTGCGTTTGTAAATCTCGGCAGAGTGCTCGCA
CAGCGCTGCCTGCAGTCTGGGATCACGGAAATGACCTGCAACGTGGAGGC
GGTACCGGGTAGCAAGCTGCAGAAGCTGCTTCAAACCATTCAGGATAATG
GGGTGTCCTTCAAGGAACCCTCTCGCCTGCCCAACGAGCAGCCCTGGGAT
GAGAAGAGGCATGAGAAGCCCTGGGAGGTGTCGGAAGACGCACTGGAAGC
ACCCAAATCAAAATAACCAAAAGAAACCACACTTAGTTATCGTTTCGTTT
AGAATAAACGTTGATTATTATTGCTAAAAAAAAAAAAAAAAAAAAAA

HL07956.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL18-RA 775 mRpL18-RA 1..775 1..775 3875 100 Plus
ox-RA 380 ox-RA 304..380 777..701 385 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8643604..8644365 1..762 3765 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:29:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12756399..12757175 1..777 3885 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12757598..12758374 1..777 3885 100 Plus
Blast to na_te.dros performed 2019-03-16 07:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
Juan 4236 Juan JUAN 4236bp 1056..1096 317..358 108 76.2 Plus

HL07956.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:31:24 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8643604..8644374 1..775 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:13:18 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL18-RA 1..561 156..716 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:31 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL18-RA 1..561 156..716 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:07:59 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL18-RA 1..561 156..716 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:55 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL18-RA 1..561 156..716 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:32:51 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL18-RA 1..561 156..716 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:22 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL18-RA 1..775 1..775 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:31 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL18-RA 1..775 1..775 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:07:59 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL18-RA 1..740 36..775 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:56 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL18-RA 1..775 1..775 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:32:51 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL18-RA 1..740 36..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:24 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12756399..12757173 1..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:24 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12756399..12757173 1..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:31:24 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12756399..12757173 1..775 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:07:59 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8643904..8644678 1..775 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:55 Download gff for HL07956.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12757598..12758372 1..775 100   Plus

HL07956.hyp Sequence

Translation from 155 to 715

> HL07956.hyp
MSRSARPLTSARVLHKIKELTTPQASTEYVINRNPRNLERLRIAYKPVGY
HLEKPGRSYWHTLEINTSGRYVSGDVKHFENGTILSASTSEWAIKQQLYK
TNDTSAFVNLGRVLAQRCLQSGITEMTCNVEAVPGSKLQKLLQTIQDNGV
SFKEPSRLPNEQPWDEKRHEKPWEVSEDALEAPKSK*

HL07956.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL18-PA 186 CG12373-PA 1..186 1..186 974 100 Plus

HL07956.pep Sequence

Translation from 155 to 715

> HL07956.pep
MSRSARPLTSARVLHKIKELTTPQASTEYVINRNPRNLERLRIAYKPVGY
HLEKPGRSYWHTLEINTSGRYVSGDVKHFENGTILSASTSEWAIKQQLYK
TNDTSAFVNLGRVLAQRCLQSGITEMTCNVEAVPGSKLQKLLQTIQDNGV
SFKEPSRLPNEQPWDEKRHEKPWEVSEDALEAPKSK*

HL07956.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11810-PA 189 GF11810-PA 1..187 1..185 859 85.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20334-PA 186 GG20334-PA 1..186 1..186 914 90.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21928-PA 186 GH21928-PA 1..180 1..179 831 85.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL18-PA 186 CG12373-PA 1..186 1..186 974 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19636-PA 188 GI19636-PA 1..180 1..180 833 84.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16737-PA 195 GL16737-PA 1..182 1..182 853 85.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11589-PA 195 GA11589-PA 1..182 1..182 853 85.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21422-PA 189 GM21422-PA 1..189 1..186 938 94.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10917-PA 189 GD10917-PA 1..189 1..186 933 93.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15001-PA 190 GJ15001-PA 1..177 1..177 845 87 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21616-PA 183 GK21616-PA 1..182 1..178 782 81.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\mRpL18-PA 186 GE12493-PA 1..186 1..186 912 91.4 Plus