![]() | BDGP Sequence Production Resources |
Search the DGRC for HL07956
Library: | HL |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 79 |
Well: | 56 |
Vector: | pOT2 |
Associated Gene/Transcript | mRpL18-RA |
Protein status: | HL07956.pep: gold |
Preliminary Size: | 716 |
Sequenced Size: | 797 |
Gene | Date | Evidence |
---|---|---|
CG12373 | 2002-01-01 | Sim4 clustering to Release 2 |
CG12373 | 2002-05-18 | Blastp of sequenced clone |
CG12373 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL18 | 2008-04-29 | Release 5.5 accounting |
mRpL18 | 2008-08-15 | Release 5.9 accounting |
mRpL18 | 2008-12-18 | 5.12 accounting |
797 bp (797 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118885
> HL07956.complete TTTGGACATTTTACAGCACCAATAAATCGTTTACCCACACTCAGTTCTGG CAGTCTGGTAACACTAAAGGCAGCTCAAAATATTTTATCGTGGTTTTGTA ATTTCCACATAAATATCAATTAAACGCGCGCTTTTTTCGGGTTTCCATCG CAAAAATGTCTCGCAGTGCTCGCCCCCTCACCTCCGCCCGTGTACTGCAC AAAATCAAGGAATTAACAACCCCGCAAGCCAGCACTGAATACGTGATCAA CCGGAATCCACGGAACTTGGAAAGATTACGCATTGCCTACAAGCCGGTAG GCTATCATCTGGAGAAACCAGGTCGTTCCTACTGGCACACTTTGGAAATC AACACCAGCGGCCGCTATGTCAGCGGCGATGTCAAGCACTTTGAGAATGG AACCATCCTGAGTGCCAGCACCTCGGAATGGGCCATTAAACAGCAGTTGT ACAAGACCAACGACACATCTGCGTTTGTAAATCTCGGCAGAGTGCTCGCA CAGCGCTGCCTGCAGTCTGGGATCACGGAAATGACCTGCAACGTGGAGGC GGTACCGGGTAGCAAGCTGCAGAAGCTGCTTCAAACCATTCAGGATAATG GGGTGTCCTTCAAGGAACCCTCTCGCCTGCCCAACGAGCAGCCCTGGGAT GAGAAGAGGCATGAGAAGCCCTGGGAGGTGTCGGAAGACGCACTGGAAGC ACCCAAATCAAAATAACCAAAAGAAACCACACTTAGTTATCGTTTCGTTT AGAATAAACGTTGATTATTATTGCTAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 8643604..8644365 | 1..762 | 3765 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 12756399..12757175 | 1..777 | 3885 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 12757598..12758374 | 1..777 | 3885 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Juan | 4236 | Juan JUAN 4236bp | 1056..1096 | 317..358 | 108 | 76.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 8643604..8644374 | 1..775 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL18-RA | 1..561 | 156..716 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL18-RA | 1..561 | 156..716 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL18-RA | 1..561 | 156..716 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL18-RA | 1..561 | 156..716 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL18-RA | 1..561 | 156..716 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL18-RA | 1..775 | 1..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL18-RA | 1..775 | 1..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL18-RA | 1..740 | 36..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL18-RA | 1..775 | 1..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL18-RA | 1..740 | 36..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12756399..12757173 | 1..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12756399..12757173 | 1..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12756399..12757173 | 1..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 8643904..8644678 | 1..775 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12757598..12758372 | 1..775 | 100 | Plus |
Translation from 155 to 715
> HL07956.hyp MSRSARPLTSARVLHKIKELTTPQASTEYVINRNPRNLERLRIAYKPVGY HLEKPGRSYWHTLEINTSGRYVSGDVKHFENGTILSASTSEWAIKQQLYK TNDTSAFVNLGRVLAQRCLQSGITEMTCNVEAVPGSKLQKLLQTIQDNGV SFKEPSRLPNEQPWDEKRHEKPWEVSEDALEAPKSK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL18-PA | 186 | CG12373-PA | 1..186 | 1..186 | 974 | 100 | Plus |
Translation from 155 to 715
> HL07956.pep MSRSARPLTSARVLHKIKELTTPQASTEYVINRNPRNLERLRIAYKPVGY HLEKPGRSYWHTLEINTSGRYVSGDVKHFENGTILSASTSEWAIKQQLYK TNDTSAFVNLGRVLAQRCLQSGITEMTCNVEAVPGSKLQKLLQTIQDNGV SFKEPSRLPNEQPWDEKRHEKPWEVSEDALEAPKSK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11810-PA | 189 | GF11810-PA | 1..187 | 1..185 | 859 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20334-PA | 186 | GG20334-PA | 1..186 | 1..186 | 914 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21928-PA | 186 | GH21928-PA | 1..180 | 1..179 | 831 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL18-PA | 186 | CG12373-PA | 1..186 | 1..186 | 974 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19636-PA | 188 | GI19636-PA | 1..180 | 1..180 | 833 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16737-PA | 195 | GL16737-PA | 1..182 | 1..182 | 853 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11589-PA | 195 | GA11589-PA | 1..182 | 1..182 | 853 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21422-PA | 189 | GM21422-PA | 1..189 | 1..186 | 938 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10917-PA | 189 | GD10917-PA | 1..189 | 1..186 | 933 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15001-PA | 190 | GJ15001-PA | 1..177 | 1..177 | 845 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21616-PA | 183 | GK21616-PA | 1..182 | 1..178 | 782 | 81.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\mRpL18-PA | 186 | GE12493-PA | 1..186 | 1..186 | 912 | 91.4 | Plus |