BDGP Sequence Production Resources |
Search the DGRC for HL08053
Library: | HL |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 80 |
Well: | 53 |
Vector: | pOT2 |
Associated Gene/Transcript | Thor-RA |
Protein status: | HL08053.pep: gold |
Preliminary Size: | 950 |
Sequenced Size: | 752 |
Gene | Date | Evidence |
---|---|---|
CG8846 | 2001-01-01 | Release 2 assignment |
CG8846 | 2002-12-11 | Blastp of sequenced clone |
CG8846 | 2003-01-01 | Sim4 clustering to Release 3 |
Thor | 2008-04-29 | Release 5.5 accounting |
Thor | 2008-08-15 | Release 5.9 accounting |
Thor | 2008-12-18 | 5.12 accounting |
752 bp (752 high quality bases) assembled on 2002-12-11
GenBank Submission: AF132557
> HL08053.complete CAACGGTGAACACATAGCAGCCACACAAGCTCTATAGCTGATACAAGCAA CGAAATACAAACAACGCAGTTTGTGTAAACAATCAAATTGTCGCAGCCAT ATCGAGTGTGCTTACACGTCCAGCGGAAAGTTTTCGAAACCAATCCAATC AATCAGCTAAGATGTCCGCTTCACCCACCGCCCGTCAAGCCATCACCCAG GCCCTGCCCATGATCACCAGGAAGGTTGTCATCTCGGATCCGATCCAGAT GCCCGAGGTGTACTCCTCGACGCCCGGCGGAACCCTCTACTCCACCACTC CTGGAGGCACCAAACTTATCTACGAGCGGGCTTTCATGAAGAATCTCCGT GGCTCCCCATTGAGCCAAACTCCGCCGTCCAACGTGCCCAGTTGCTTGCT GAGGGGAACTCCGCGTACTCCCTTCCGCAAGTGCGTGCCCGTCCCCACGG AACTGATCAAGCAGACCAAGTCGCTGAAGATTGAGGACCAGGAACAGTTC CAACTGGATCTGTAGGGGGTGTGGCGTGTACACCGCCATGCAGCAACTGC CAAATCCAACTAGTTCTTAGATGCACCCACTAAAACCGATCTTATAAGCT TAGTGTACCCATTAACTAGATGCTAAGTTCTTAGTTCTTCCACCTTGTTT GTTCTCTCGGTCATATTGACCCCGTTACCTTGTAAAATCGTAGATCTTAA GTAAAATGCAATAAAAAAAAGGCACACATTATTTAAAAAAAAAAAAAAAA AA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Thor-RA | 959 | Thor-RA | 97..834 | 1..738 | 3690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 3478039..3478344 | 1..306 | 99 | -> | Plus |
chr2L | 3478769..3479195 | 307..734 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Thor-RA | 1..354 | 162..515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Thor-RA | 1..354 | 162..515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Thor-RA | 1..354 | 162..515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Thor-RA | 1..354 | 162..515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Thor-RA | 1..354 | 162..515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Thor-RA | 22..755 | 1..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Thor-RA | 22..755 | 1..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Thor-RA | 22..755 | 1..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Thor-RA | 22..755 | 1..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Thor-RA | 22..755 | 1..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3478455..3478760 | 1..306 | 100 | -> | Plus |
2L | 3479185..3479612 | 307..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3478455..3478760 | 1..306 | 100 | -> | Plus |
2L | 3479185..3479612 | 307..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3478455..3478760 | 1..306 | 100 | -> | Plus |
2L | 3479185..3479612 | 307..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 3478455..3478760 | 1..306 | 100 | -> | Plus |
arm_2L | 3479185..3479612 | 307..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3478455..3478760 | 1..306 | 100 | -> | Plus |
2L | 3479185..3479612 | 307..734 | 100 | Plus |
Translation from 161 to 514
> HL08053.hyp MSASPTARQAITQALPMITRKVVISDPIQMPEVYSSTPGGTLYSTTPGGT KLIYERAFMKNLRGSPLSQTPPSNVPSCLLRGTPRTPFRKCVPVPTELIK QTKSLKIEDQEQFQLDL*
Translation from 161 to 514
> HL08053.pep MSASPTARQAITQALPMITRKVVISDPIQMPEVYSSTPGGTLYSTTPGGT KLIYERAFMKNLRGSPLSQTPPSNVPSCLLRGTPRTPFRKCVPVPTELIK QTKSLKIEDQEQFQLDL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15239-PA | 117 | GF15239-PA | 1..117 | 1..117 | 577 | 93.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24948-PA | 117 | GG24948-PA | 1..117 | 1..117 | 600 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10216-PA | 121 | GH10216-PA | 1..121 | 1..117 | 523 | 83.5 | Plus |
Dgri\GH10214-PA | 121 | GH10214-PA | 1..121 | 1..117 | 518 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Thor-PB | 117 | CG8846-PB | 1..117 | 1..117 | 601 | 100 | Plus |
Thor-PA | 117 | CG8846-PA | 1..117 | 1..117 | 601 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14996-PA | 120 | GI14996-PA | 1..120 | 1..117 | 547 | 86.7 | Plus |
Dmoj\GI15007-PA | 120 | GI15007-PA | 1..120 | 1..117 | 534 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18656-PA | 121 | GL18656-PA | 1..121 | 1..117 | 548 | 85.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21364-PA | 121 | GA21364-PA | 1..121 | 1..117 | 548 | 85.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11143-PA | 117 | GM11143-PA | 1..117 | 1..117 | 600 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\Thor-PA | 117 | GD23237-PA | 1..117 | 1..117 | 600 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17238-PA | 120 | GJ17238-PA | 1..120 | 1..117 | 533 | 85 | Plus |
Dvir\GJ17239-PA | 120 | GJ17239-PA | 1..120 | 1..117 | 533 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18436-PA | 122 | GK18436-PA | 1..122 | 1..117 | 542 | 85.2 | Plus |
Dwil\GK10406-PA | 122 | GK10406-PA | 1..122 | 1..117 | 542 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\Thor-PA | 117 | GE18239-PA | 1..117 | 1..117 | 599 | 98.3 | Plus |