Clone HL08053 Report

Search the DGRC for HL08053

Clone and Library Details

Library:HL
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:80
Well:53
Vector:pOT2
Associated Gene/TranscriptThor-RA
Protein status:HL08053.pep: gold
Preliminary Size:950
Sequenced Size:752

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8846 2001-01-01 Release 2 assignment
CG8846 2002-12-11 Blastp of sequenced clone
CG8846 2003-01-01 Sim4 clustering to Release 3
Thor 2008-04-29 Release 5.5 accounting
Thor 2008-08-15 Release 5.9 accounting
Thor 2008-12-18 5.12 accounting

Clone Sequence Records

HL08053.complete Sequence

752 bp (752 high quality bases) assembled on 2002-12-11

GenBank Submission: AF132557

> HL08053.complete
CAACGGTGAACACATAGCAGCCACACAAGCTCTATAGCTGATACAAGCAA
CGAAATACAAACAACGCAGTTTGTGTAAACAATCAAATTGTCGCAGCCAT
ATCGAGTGTGCTTACACGTCCAGCGGAAAGTTTTCGAAACCAATCCAATC
AATCAGCTAAGATGTCCGCTTCACCCACCGCCCGTCAAGCCATCACCCAG
GCCCTGCCCATGATCACCAGGAAGGTTGTCATCTCGGATCCGATCCAGAT
GCCCGAGGTGTACTCCTCGACGCCCGGCGGAACCCTCTACTCCACCACTC
CTGGAGGCACCAAACTTATCTACGAGCGGGCTTTCATGAAGAATCTCCGT
GGCTCCCCATTGAGCCAAACTCCGCCGTCCAACGTGCCCAGTTGCTTGCT
GAGGGGAACTCCGCGTACTCCCTTCCGCAAGTGCGTGCCCGTCCCCACGG
AACTGATCAAGCAGACCAAGTCGCTGAAGATTGAGGACCAGGAACAGTTC
CAACTGGATCTGTAGGGGGTGTGGCGTGTACACCGCCATGCAGCAACTGC
CAAATCCAACTAGTTCTTAGATGCACCCACTAAAACCGATCTTATAAGCT
TAGTGTACCCATTAACTAGATGCTAAGTTCTTAGTTCTTCCACCTTGTTT
GTTCTCTCGGTCATATTGACCCCGTTACCTTGTAAAATCGTAGATCTTAA
GTAAAATGCAATAAAAAAAAGGCACACATTATTTAAAAAAAAAAAAAAAA
AA

HL08053.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Thor-RA 959 Thor-RA 97..834 1..738 3690 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3478767..3479195 305..734 2085 99.5 Plus
chr2L 23010047 chr2L 3478039..3478345 1..307 1505 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:29:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3479183..3479616 305..738 2170 100 Plus
2L 23513712 2L 3478455..3478761 1..307 1535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3479183..3479616 305..738 2170 100 Plus
2L 23513712 2L 3478455..3478761 1..307 1535 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:56:37 has no hits.

HL08053.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:57:21 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3478039..3478344 1..306 99 -> Plus
chr2L 3478769..3479195 307..734 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:13:36 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
Thor-RA 1..354 162..515 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:00:07 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
Thor-RA 1..354 162..515 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:25 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
Thor-RA 1..354 162..515 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:50:41 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
Thor-RA 1..354 162..515 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:23:51 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
Thor-RA 1..354 162..515 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:17:16 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
Thor-RA 22..755 1..734 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:00:07 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
Thor-RA 22..755 1..734 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:25 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
Thor-RA 22..755 1..734 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:50:41 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
Thor-RA 22..755 1..734 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:23:51 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
Thor-RA 22..755 1..734 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:21 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3478455..3478760 1..306 100 -> Plus
2L 3479185..3479612 307..734 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:21 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3478455..3478760 1..306 100 -> Plus
2L 3479185..3479612 307..734 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:21 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3478455..3478760 1..306 100 -> Plus
2L 3479185..3479612 307..734 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:25 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3478455..3478760 1..306 100 -> Plus
arm_2L 3479185..3479612 307..734 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:22:27 Download gff for HL08053.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3478455..3478760 1..306 100 -> Plus
2L 3479185..3479612 307..734 100   Plus

HL08053.hyp Sequence

Translation from 161 to 514

> HL08053.hyp
MSASPTARQAITQALPMITRKVVISDPIQMPEVYSSTPGGTLYSTTPGGT
KLIYERAFMKNLRGSPLSQTPPSNVPSCLLRGTPRTPFRKCVPVPTELIK
QTKSLKIEDQEQFQLDL*

HL08053.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Thor-PB 117 CG8846-PB 1..117 1..117 601 100 Plus
Thor-PA 117 CG8846-PA 1..117 1..117 601 100 Plus

HL08053.pep Sequence

Translation from 161 to 514

> HL08053.pep
MSASPTARQAITQALPMITRKVVISDPIQMPEVYSSTPGGTLYSTTPGGT
KLIYERAFMKNLRGSPLSQTPPSNVPSCLLRGTPRTPFRKCVPVPTELIK
QTKSLKIEDQEQFQLDL*

HL08053.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15239-PA 117 GF15239-PA 1..117 1..117 577 93.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24948-PA 117 GG24948-PA 1..117 1..117 600 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10216-PA 121 GH10216-PA 1..121 1..117 523 83.5 Plus
Dgri\GH10214-PA 121 GH10214-PA 1..121 1..117 518 82.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Thor-PB 117 CG8846-PB 1..117 1..117 601 100 Plus
Thor-PA 117 CG8846-PA 1..117 1..117 601 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14996-PA 120 GI14996-PA 1..120 1..117 547 86.7 Plus
Dmoj\GI15007-PA 120 GI15007-PA 1..120 1..117 534 85 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18656-PA 121 GL18656-PA 1..121 1..117 548 85.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21364-PA 121 GA21364-PA 1..121 1..117 548 85.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11143-PA 117 GM11143-PA 1..117 1..117 600 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Thor-PA 117 GD23237-PA 1..117 1..117 600 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17238-PA 120 GJ17238-PA 1..120 1..117 533 85 Plus
Dvir\GJ17239-PA 120 GJ17239-PA 1..120 1..117 533 85 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18436-PA 122 GK18436-PA 1..122 1..117 542 85.2 Plus
Dwil\GK10406-PA 122 GK10406-PA 1..122 1..117 542 85.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Thor-PA 117 GE18239-PA 1..117 1..117 599 98.3 Plus