BDGP Sequence Production Resources |
Search the DGRC for HL08110
Library: | HL |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1997-11-24 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 81 |
Well: | 10 |
Vector: | pOT2 |
Associated Gene/Transcript | Zasp66-RA |
Protein status: | HL08110.pep: gold |
Sequenced Size: | 1189 |
Gene | Date | Evidence |
---|---|---|
Lost to the ancients | 2009-06-22 | I'm sure there was a reason |
1189 bp assembled on 2009-06-22
GenBank Submission: BT088849.1
> HL08110.complete AAAAATAAACAACAATAAGACTCGAGCTCGAGCATCCTTTTTGTAGTGAA TCCTAGTGTAAAGATCTCCGATCTCACCAGCTGCAGCGTTGATTTAAACG TGACGAAGAAGAGTTTAAATTCAAACACAAAACACACACATTGCAAAAAT GGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCAGC CAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGCTG GTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCCTA CTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGACT ACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACAAG GTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTCAA CTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATCAGAT CCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTCCT TTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTCCA GTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGGCG GCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTGTG CAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCAGT ATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGATG AGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGATT GGTGCCACCGAGTACTAGAAAGTGCAGCTGCAACACCAGCGACAGCAGCA ACATCAACATCAACGCAACATCGGCAACATCTGCTGCACTTGTTTTATCT CCTAACATATTTAGCGGATTTTTATGAAATTCTGTTTAACTTACTCAATA AATTATATGAAGAACGACAAGAAATTGTGAACCACTAACAAGCTTGATGA TATAATGGATTGGTAATCAATTGGCATCGAAATAAATTTACGATATAAAC ACCACTTAACGCCGCCTCAACCTAATTACTGTTTGCATATGCAATAGAAA ACGTATATAAATTAATTAAATAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-RA | 1401 | Zasp66-RA | 62..1242 | 1..1181 | 5890 | 99.9 | Plus |
Zasp66-RJ | 1325 | Zasp66-RJ | 248..1318 | 111..1181 | 5340 | 99.9 | Plus |
Zasp66-RI | 1390 | Zasp66-RI | 631..1229 | 583..1181 | 2980 | 99.8 | Plus |
Zasp66-RI | 1390 | Zasp66-RI | 121..632 | 1..512 | 2560 | 100 | Plus |
Zasp66-RJ | 1325 | Zasp66-RJ | 1..108 | 4..111 | 540 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8630302..8630691 | 782..1171 | 1920 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 8626610..8626816 | 226..432 | 1005 | 99 | Plus |
chr3L | 24539361 | chr3L | 8629473..8629633 | 582..742 | 805 | 100 | Plus |
chr3L | 24539361 | chr3L | 8622548..8622666 | 111..229 | 595 | 100 | Plus |
chr3L | 24539361 | chr3L | 8622298..8622408 | 1..111 | 555 | 100 | Plus |
chr3L | 24539361 | chr3L | 8627036..8627112 | 434..510 | 370 | 98.7 | Plus |
chr3L | 24539361 | chr3L | 8627718..8627800 | 511..593 | 370 | 96.4 | Plus |
chr3L | 24539361 | chr3L | 8630190..8630233 | 741..784 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8638267..8638666 | 782..1181 | 1985 | 99.8 | Plus |
3L | 28110227 | 3L | 8634579..8634785 | 226..432 | 1020 | 99.5 | Plus |
3L | 28110227 | 3L | 8637438..8637598 | 582..742 | 805 | 100 | Plus |
3L | 28110227 | 3L | 8630517..8630635 | 111..229 | 595 | 100 | Plus |
3L | 28110227 | 3L | 8630267..8630377 | 1..111 | 555 | 100 | Plus |
3L | 28110227 | 3L | 8635002..8635081 | 431..510 | 400 | 100 | Plus |
3L | 28110227 | 3L | 8635681..8635763 | 511..593 | 370 | 96.4 | Plus |
3L | 28110227 | 3L | 8638155..8638198 | 741..784 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 8631367..8631766 | 782..1181 | 1985 | 99.7 | Plus |
3L | 28103327 | 3L | 8627679..8627885 | 226..432 | 1020 | 99.5 | Plus |
3L | 28103327 | 3L | 8630538..8630698 | 582..742 | 805 | 100 | Plus |
3L | 28103327 | 3L | 8623617..8623735 | 111..229 | 595 | 100 | Plus |
3L | 28103327 | 3L | 8623367..8623477 | 1..111 | 555 | 100 | Plus |
3L | 28103327 | 3L | 8628102..8628181 | 431..510 | 400 | 100 | Plus |
3L | 28103327 | 3L | 8628781..8628863 | 511..593 | 370 | 96.3 | Plus |
3L | 28103327 | 3L | 8631255..8631298 | 741..784 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6828..6890 | 870..931 | 186 | 79.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2295..2371 | 862..938 | 177 | 73.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6721..6804 | 859..938 | 167 | 70.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1512..1587 | 869..937 | 166 | 73.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6722..6783 | 875..938 | 162 | 76.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6798..6879 | 861..938 | 157 | 69.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2761..2840 | 861..939 | 155 | 71.1 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1083..1154 | 861..931 | 150 | 69.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6753..6825 | 870..938 | 148 | 71.2 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1092..1273 | 861..1031 | 148 | 59.1 | Plus |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 3280..3345 | 870..934 | 147 | 71.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2340..2404 | 875..938 | 142 | 70.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6774..6839 | 870..931 | 140 | 72.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2789..2854 | 874..938 | 138 | 69.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6794..6855 | 875..938 | 135 | 70.3 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2383..2461 | 861..938 | 133 | 67.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2632..2665 | 876..909 | 125 | 85.3 | Plus |
Doc3-element | 4740 | Doc3-element DOC3 4740bp | 528..577 | 866..918 | 123 | 73.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2418..2484 | 856..928 | 117 | 67.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1541..1581 | 874..914 | 115 | 75.6 | Plus |
gypsy10 | 6006 | gypsy10 GYPSY10 6006bp | 65..127 | 471..532 | 114 | 68.8 | Plus |
gypsy10 | 6006 | gypsy10 GYPSY10 6006bp | 5707..5769 | 471..532 | 114 | 68.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2602..2665 | 861..920 | 112 | 68.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8622298..8622411 | 1..113 | 98 | -> | Plus |
chr3L | 8622551..8622666 | 114..229 | 100 | -> | Plus |
chr3L | 8626614..8626814 | 230..430 | 99 | -> | Plus |
chr3L | 8627033..8627112 | 431..510 | 97 | -> | Plus |
chr3L | 8627718..8627789 | 511..582 | 100 | -> | Plus |
chr3L | 8629474..8629633 | 583..742 | 100 | -> | Plus |
chr3L | 8630192..8630230 | 743..781 | 100 | -> | Plus |
chr3L | 8630302..8630393 | 782..873 | 100 | == | Plus |
chr3L | 8630460..8630673 | 940..1153 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RA | 1..720 | 149..868 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RA | 1..720 | 149..868 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RJ | 1..720 | 149..868 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RJ | 1..720 | 149..868 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RA | 22..1189 | 1..1171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RA | 60..1230 | 1..1171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RA | 25..1195 | 1..1171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RA | 25..1195 | 1..1171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8635681..8635752 | 511..582 | 100 | -> | Plus |
3L | 8637439..8637598 | 583..742 | 100 | -> | Plus |
3L | 8638157..8638195 | 743..781 | 100 | -> | Plus |
3L | 8630520..8630635 | 114..229 | 100 | -> | Plus |
3L | 8634583..8634783 | 230..430 | 100 | -> | Plus |
3L | 8635002..8635081 | 431..510 | 100 | -> | Plus |
3L | 8630267..8630380 | 1..113 | 98 | -> | Plus |
3L | 8638267..8638656 | 782..1171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8635681..8635752 | 511..582 | 100 | -> | Plus |
3L | 8637439..8637598 | 583..742 | 100 | -> | Plus |
3L | 8638157..8638195 | 743..781 | 100 | -> | Plus |
3L | 8630520..8630635 | 114..229 | 100 | -> | Plus |
3L | 8634583..8634783 | 230..430 | 100 | -> | Plus |
3L | 8635002..8635081 | 431..510 | 100 | -> | Plus |
3L | 8630267..8630380 | 1..113 | 98 | -> | Plus |
3L | 8638267..8638656 | 782..1171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8635681..8635752 | 511..582 | 100 | -> | Plus |
3L | 8637439..8637598 | 583..742 | 100 | -> | Plus |
3L | 8638157..8638195 | 743..781 | 100 | -> | Plus |
3L | 8630520..8630635 | 114..229 | 100 | -> | Plus |
3L | 8634583..8634783 | 230..430 | 100 | -> | Plus |
3L | 8635002..8635081 | 431..510 | 100 | -> | Plus |
3L | 8630267..8630380 | 1..113 | 98 | -> | Plus |
3L | 8638267..8638656 | 782..1171 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8628781..8628852 | 511..582 | 100 | -> | Plus |
arm_3L | 8630539..8630698 | 583..742 | 100 | -> | Plus |
arm_3L | 8631257..8631295 | 743..781 | 100 | -> | Plus |
arm_3L | 8631367..8631756 | 782..1171 | 99 | Plus | |
arm_3L | 8623367..8623480 | 1..113 | 98 | -> | Plus |
arm_3L | 8623620..8623735 | 114..229 | 100 | -> | Plus |
arm_3L | 8627683..8627883 | 230..430 | 100 | -> | Plus |
arm_3L | 8628102..8628181 | 431..510 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8627683..8627883 | 230..430 | 100 | -> | Plus |
3L | 8628102..8628181 | 431..510 | 100 | -> | Plus |
3L | 8628781..8628852 | 511..582 | 100 | -> | Plus |
3L | 8630539..8630698 | 583..742 | 100 | -> | Plus |
3L | 8631257..8631295 | 743..781 | 100 | -> | Plus |
3L | 8631367..8631756 | 782..1171 | 99 | Plus | |
3L | 8623367..8623480 | 1..113 | 98 | -> | Plus |
3L | 8623620..8623735 | 114..229 | 100 | -> | Plus |
Translation from 148 to 867
> HL08110.pep MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24342-PA | 430 | GF24342-PA | 191..430 | 1..239 | 1230 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14334-PA | 429 | GG14334-PA | 191..429 | 1..239 | 1263 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15318-PA | 149 | GH15318-PA | 5..149 | 95..239 | 697 | 91 | Plus |
Dgri\GH22528-PA | 181 | GH22528-PA | 1..122 | 1..122 | 637 | 94.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-PA | 239 | CG6416-PA | 1..239 | 1..239 | 1279 | 100 | Plus |
Zasp66-PJ | 239 | CG6416-PJ | 1..239 | 1..239 | 1279 | 100 | Plus |
Zasp66-PF | 402 | CG6416-PF | 177..402 | 17..239 | 1136 | 96 | Plus |
Zasp66-PE | 430 | CG6416-PE | 205..430 | 17..239 | 1136 | 96 | Plus |
Zasp66-PI | 215 | CG6416-PI | 1..215 | 1..239 | 1118 | 90 | Plus |
Zasp66-PK | 378 | CG6416-PK | 177..378 | 17..239 | 975 | 85.4 | Plus |
Zasp66-PN | 406 | CG6416-PN | 205..406 | 17..239 | 975 | 85.4 | Plus |
Zasp66-PH | 135 | CG6416-PH | 1..121 | 1..121 | 656 | 100 | Plus |
Zasp66-PG | 165 | CG6416-PG | 1..121 | 1..121 | 656 | 100 | Plus |
Zasp66-PM | 322 | CG6416-PM | 177..320 | 17..157 | 647 | 87.5 | Plus |
Zasp66-PB | 298 | CG6416-PB | 177..284 | 17..121 | 513 | 91.7 | Plus |
Zasp66-PO | 326 | CG6416-PO | 205..312 | 17..121 | 513 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12917-PA | 429 | GI12917-PA | 191..429 | 1..239 | 1226 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10326-PA | 417 | GL10326-PA | 229..373 | 1..145 | 757 | 95.9 | Plus |
Dper\GL10327-PA | 113 | GL10327-PA | 29..113 | 156..239 | 406 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19576-PA | 240 | GA19576-PA | 1..240 | 1..239 | 1213 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25076-PA | 429 | GM25076-PA | 191..429 | 1..239 | 1270 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14114-PA | 231 | GD14114-PA | 177..231 | 185..239 | 217 | 78.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13061-PA | 429 | GJ13061-PA | 191..429 | 1..239 | 1213 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16724-PA | 243 | GK16724-PA | 1..243 | 1..239 | 1198 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20762-PA | 429 | GE20762-PA | 191..429 | 1..239 | 1265 | 99.6 | Plus |
Translation from 148 to 867
> HL08110.hyp MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-PA | 239 | CG6416-PA | 1..239 | 1..239 | 1279 | 100 | Plus |
Zasp66-PJ | 239 | CG6416-PJ | 1..239 | 1..239 | 1279 | 100 | Plus |
Zasp66-PF | 402 | CG6416-PF | 177..402 | 17..239 | 1136 | 96 | Plus |
Zasp66-PE | 430 | CG6416-PE | 205..430 | 17..239 | 1136 | 96 | Plus |
Zasp66-PI | 215 | CG6416-PI | 1..215 | 1..239 | 1118 | 90 | Plus |