Clone HL08141 Report

Search the DGRC for HL08141

Clone and Library Details

Library:HL
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1997-11-24
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:81
Well:41
Vector:pOT2
Associated Gene/TranscriptCG9578-RA
Protein status:HL08141.pep: gold
Preliminary Size:4600
Sequenced Size:1046

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9578 2001-01-01 Release 2 assignment
CG9578 2001-09-19 Blastp of sequenced clone
CG9578 2003-01-01 Sim4 clustering to Release 3
CG9578 2008-04-29 Release 5.5 accounting
CG9578 2008-08-15 Release 5.9 accounting
CG9578 2008-12-18 5.12 accounting

Clone Sequence Records

HL08141.complete Sequence

1046 bp (1046 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058495

> HL08141.complete
TTTGGAACAGTATTTTCGACTTAGACAGACACTTTGAAATCATTTGACAT
ATCTTTAGAATGTCCATGGAGGAGTGCTTTGTGCCCCGGCTGCCGGTGGA
CAGCGAGTTCATCCAGTTCCACGACTGGGCCATCAAGTATGAGAAGTCGC
ACATCCTGAAGAGCAGCTGCCAACTGGGCACCGCCAAGTGCTGTCCCAAG
GACTCGGCCGACCGCTGCGACCTCTGCCACTACCAGCACTCCCTGCAGCT
GCCCCACCTGCCCGACATGGTGTTCCACAAGAATCGGCTGGTGTTACAGC
ACAAGGACGGCGCCACTCTCGAGTTCTGCCCCATGGACGCGCTGGCGCTG
GTGGACAATGGGAAGCAGCCGCTGGAGGTCGCTTGTGCTCAGGAGTGGCG
GGAAACGCGTAACGAGCAGACAATGGAGGAGAAGTTCAAGCCTTTCGACT
GGACATTCACCTCCACCTACCAGGGCACCATGAACGAAAAAGTGCGATCG
GAGACCACGAATCAGACGCTGAACAAGTTCAAGCTGATGCAGCGCGAGAA
CATCATCTTCTACCACGATTTAACTCTGTTCGAGGATGAGCTGCACGACC
ACGGAATATCGGTGATGAGCGTGCGAATCCGCGTGATGCCCTCTGGCTTC
TTCATCCTTTTGCGCCACTTTCTGCGCGTGGACCACGTGCTAATCCGGAT
GCACGACACCCGCTTCCACCACGAGATCGAGAACGACTTTATCCTGAAAG
AGTACATCCATCGGGAGGCGCCTTGCACTGAGCTTCAAAACTGTGTGGCC
TTCTGGACCAACCCGGATGAAATGCAAGAATTTGTGCCCGTGAAGTCCAA
GCAGTTGCACAAGCTCTTCTTTAAGTAGTCCCGATGTCCGATGCTAGATG
CCAGATCCCAGATCTCTAGGTTTATGTCAGTCGTCGCATTGGTTACAACT
GCTGCTATATGCGTTTATTTATTGCCAACAGTGTGCGCATGCGCAGACGA
CATTAAAAGCGATTTTCCTAAAAGGCAAAAAAAAAAAAAAAAAAAA

HL08141.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9578-RA 1136 CG9578-RA 111..1136 1..1026 5130 100 Plus
AnnX-RA 1250 AnnX-RA 1167..1250 1027..944 420 100 Minus
AnnX-RB 1244 AnnX-RB 1162..1244 1027..945 415 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20059678..20060074 630..1026 1985 100 Plus
chrX 22417052 chrX 20058970..20059306 73..409 1685 100 Plus
chrX 22417052 chrX 20059393..20059613 409..629 1105 100 Plus
chrX 22417052 chrX 20058838..20058911 1..74 370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:30:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20171130..20171527 630..1027 1990 100 Plus
X 23542271 X 20170422..20170758 73..409 1685 100 Plus
X 23542271 X 20170845..20171065 409..629 1105 100 Plus
X 23542271 X 20170290..20170363 1..74 370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20179228..20179625 630..1027 1990 100 Plus
X 23527363 X 20178520..20178856 73..409 1685 100 Plus
X 23527363 X 20178943..20179163 409..629 1105 100 Plus
X 23527363 X 20178388..20178461 1..74 370 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:15:16 has no hits.

HL08141.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:15:55 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20058838..20058911 1..74 100 -> Plus
chrX 20058972..20059306 75..409 100 -> Plus
chrX 20059394..20059613 410..629 100 -> Plus
chrX 20059678..20060074 630..1026 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:13:49 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
CG9578-RA 1..819 60..878 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:04:15 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
CG9578-RA 1..819 60..878 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:13:01 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
CG9578-RA 1..819 60..878 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:34:52 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
CG9578-RA 1..819 60..878 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:16:03 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
CG9578-RA 1..819 60..878 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:53:10 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
CG9578-RA 49..1074 1..1026 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:04:14 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
CG9578-RA 76..1101 1..1026 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:13:01 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
CG9578-RA 69..1094 1..1026 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:34:52 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
CG9578-RA 49..1074 1..1026 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:16:03 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
CG9578-RA 69..1094 1..1026 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:55 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
X 20170290..20170363 1..74 100 -> Plus
X 20170424..20170758 75..409 100 -> Plus
X 20170846..20171065 410..629 100 -> Plus
X 20171130..20171526 630..1026 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:55 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
X 20170290..20170363 1..74 100 -> Plus
X 20170424..20170758 75..409 100 -> Plus
X 20170846..20171065 410..629 100 -> Plus
X 20171130..20171526 630..1026 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:55 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
X 20170290..20170363 1..74 100 -> Plus
X 20170424..20170758 75..409 100 -> Plus
X 20170846..20171065 410..629 100 -> Plus
X 20171130..20171526 630..1026 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:13:01 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20064323..20064396 1..74 100 -> Plus
arm_X 20064457..20064791 75..409 100 -> Plus
arm_X 20064879..20065098 410..629 100 -> Plus
arm_X 20065163..20065559 630..1026 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:11:48 Download gff for HL08141.complete
Subject Subject Range Query Range Percent Splice Strand
X 20178388..20178461 1..74 100 -> Plus
X 20178522..20178856 75..409 100 -> Plus
X 20178944..20179163 410..629 100 -> Plus
X 20179228..20179624 630..1026 100   Plus

HL08141.pep Sequence

Translation from 59 to 877

> HL08141.pep
MSMEECFVPRLPVDSEFIQFHDWAIKYEKSHILKSSCQLGTAKCCPKDSA
DRCDLCHYQHSLQLPHLPDMVFHKNRLVLQHKDGATLEFCPMDALALVDN
GKQPLEVACAQEWRETRNEQTMEEKFKPFDWTFTSTYQGTMNEKVRSETT
NQTLNKFKLMQRENIIFYHDLTLFEDELHDHGISVMSVRIRVMPSGFFIL
LRHFLRVDHVLIRMHDTRFHHEIENDFILKEYIHREAPCTELQNCVAFWT
NPDEMQEFVPVKSKQLHKLFFK*

HL08141.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20238-PA 271 GF20238-PA 4..271 5..272 1290 86.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19274-PA 271 GG19274-PA 4..271 5..272 1348 92.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12616-PA 274 GH12616-PA 4..274 5..272 1135 76.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9578-PA 272 CG9578-PA 1..272 1..272 1486 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11031-PA 272 GI11031-PA 4..272 5..272 1166 78.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13081-PA 272 GL13081-PA 1..271 1..271 1223 81.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21888-PA 272 GA21888-PA 5..271 5..271 1224 82.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23013-PA 284 GM23013-PA 1..284 1..272 1218 83.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15812-PA 272 GJ15812-PA 4..272 5..272 1192 80.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25338-PA 271 GK25338-PA 3..271 4..272 1244 83.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15892-PA 271 GE15892-PA 4..271 5..272 1341 92.5 Plus

HL08141.hyp Sequence

Translation from 59 to 877

> HL08141.hyp
MSMEECFVPRLPVDSEFIQFHDWAIKYEKSHILKSSCQLGTAKCCPKDSA
DRCDLCHYQHSLQLPHLPDMVFHKNRLVLQHKDGATLEFCPMDALALVDN
GKQPLEVACAQEWRETRNEQTMEEKFKPFDWTFTSTYQGTMNEKVRSETT
NQTLNKFKLMQRENIIFYHDLTLFEDELHDHGISVMSVRIRVMPSGFFIL
LRHFLRVDHVLIRMHDTRFHHEIENDFILKEYIHREAPCTELQNCVAFWT
NPDEMQEFVPVKSKQLHKLFFK*

HL08141.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG9578-PA 272 CG9578-PA 1..272 1..272 1486 100 Plus