Clone IP01034 Report

Search the DGRC for IP01034

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:10
Well:34
Vector:pOT2
Associated Gene/TranscriptCG12173-RA
Protein status:IP01034.pep: gold
Sequenced Size:862

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12173 2005-01-01 Successful iPCR screen
CG12173 2008-04-29 Release 5.5 accounting
CG12173 2008-08-15 Release 5.9 accounting
CG12173 2008-12-18 5.12 accounting

Clone Sequence Records

IP01034.complete Sequence

862 bp (862 high quality bases) assembled on 2005-03-24

GenBank Submission: BT023405

> IP01034.complete
GCTGGGCGGAAAATCAACTGGTTCCTCGTGATAACTTAATCCCACTAATA
AGCGCAATGTCGTCCAGTGAACGAGTGGCCAAAGTGGTGCTGGTGGACAT
CGAGGGCACCACCACTTCGATTAGCTTTGTGCACGATGTCCTGTTTCCCT
ACGCCAAGCAGAATGTGGAAAAGTTCCTGAGGGATTCGTGGGAAGAAGAT
GATATAAAGCGTATTGTCCAGGATCTACAGCAAGTGCCCCAGTATGCGGA
CTACAAGGCCCTGTTAAGTGGTCCACCTACGGAAGTGGATGTAGATCTGA
TTGCAGGCTTTGTGCGCTATTTAATTGATCAGGATCTGAAGGTCACGCCA
ATGAAAACGCTGCAGGGCTTGATTTGGGCGCAGGGCTACGCTAATGGAGA
GCTGAAGGGCCATGTATACGAAGACGTCCCTGCAGCTTTTGAGGCTTGGC
GTGCTGCTGGCCTCCAGATTGCAGTCTACTCCAGCGGCAGTGTGGCTGCC
CAAAAGCTGATATTCGGTCATAGTTTGGCCGGGAACCTGCAGCCGTACTT
GAGTGCTTATTTCGACACCCATGTGGGCCACAAACAGGAACAGCAGTCCT
ATAAAAACATTGCCAAGCAATTGAAGGAGGACCCGAAGCAGATACTCTTT
CTCACGGATATTCCAGGAGAAGCGGCCGCCGCTCGCTGTGCGGGCTTGCA
AGCCATAATTCTGAAGCGTCCTGGAAACGCCGCCCTAGCAGACGATCAAA
AAACTGGATTCGAGTTGATTCCGGACTTTAAACCACTTCACAACCTGAAA
GTTCCGGTCAATAAATCCCAGGCTTAGGTCATTCCAAAAAAGTATAAAAA
AAAAAAAAAAAA

IP01034.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12173-RB 914 CG12173-RB 63..908 1..846 4230 100 Plus
CG12173-RA 914 CG12173-RA 63..908 1..846 4230 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1081912..1082323 412..1 2060 100 Minus
chr3R 27901430 chr3R 1081346..1081602 669..413 1285 100 Minus
chr3R 27901430 chr3R 1081108..1081285 845..668 890 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:30:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5256248..5256659 412..1 2060 100 Minus
3R 32079331 3R 5255682..5255938 669..413 1285 100 Minus
3R 32079331 3R 5255443..5255621 846..668 895 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4997079..4997490 412..1 2060 100 Minus
3R 31820162 3R 4996513..4996769 669..413 1285 100 Minus
3R 31820162 3R 4996274..4996452 846..668 895 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:15:36 has no hits.

IP01034.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:16:16 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1081108..1081283 670..845 100 <- Minus
chr3R 1081346..1081602 413..669 100 <- Minus
chr3R 1081912..1082323 1..412 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:13:58 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG12173-RA 1..771 57..827 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:03:45 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG12173-RB 1..771 57..827 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:51 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG12173-RA 1..771 57..827 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:48:57 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG12173-RA 1..771 57..827 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:24:34 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG12173-RA 1..771 57..827 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:49:53 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG12173-RA 1..819 9..827 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:03:45 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG12173-RB 43..887 1..845 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:51 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG12173-RA 23..867 1..845 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:48:57 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG12173-RA 1..819 9..827 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:24:34 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
CG12173-RA 23..867 1..845 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:16 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5255682..5255938 413..669 100 <- Minus
3R 5255444..5255619 670..845 100 <- Minus
3R 5256248..5256659 1..412 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:16 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5255682..5255938 413..669 100 <- Minus
3R 5255444..5255619 670..845 100 <- Minus
3R 5256248..5256659 1..412 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:16 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5255682..5255938 413..669 100 <- Minus
3R 5255444..5255619 670..845 100 <- Minus
3R 5256248..5256659 1..412 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:51 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1081166..1081341 670..845 100 <- Minus
arm_3R 1081404..1081660 413..669 100 <- Minus
arm_3R 1081970..1082381 1..412 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:23:31 Download gff for IP01034.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4996513..4996769 413..669 100 <- Minus
3R 4997079..4997490 1..412 100   Minus
3R 4996275..4996450 670..845 100 <- Minus

IP01034.hyp Sequence

Translation from 2 to 826

> IP01034.hyp
WAENQLVPRDNLIPLISAMSSSERVAKVVLVDIEGTTTSISFVHDVLFPY
AKQNVEKFLRDSWEEDDIKRIVQDLQQVPQYADYKALLSGPPTEVDVDLI
AGFVRYLIDQDLKVTPMKTLQGLIWAQGYANGELKGHVYEDVPAAFEAWR
AAGLQIAVYSSGSVAAQKLIFGHSLAGNLQPYLSAYFDTHVGHKQEQQSY
KNIAKQLKEDPKQILFLTDIPGEAAAARCAGLQAIILKRPGNAALADDQK
TGFELIPDFKPLHNLKVPVNKSQA*

IP01034.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG12173-PA 256 CG12173-PA 1..256 19..274 1314 100 Plus

IP01034.pep Sequence

Translation from 56 to 826

> IP01034.pep
MSSSERVAKVVLVDIEGTTTSISFVHDVLFPYAKQNVEKFLRDSWEEDDI
KRIVQDLQQVPQYADYKALLSGPPTEVDVDLIAGFVRYLIDQDLKVTPMK
TLQGLIWAQGYANGELKGHVYEDVPAAFEAWRAAGLQIAVYSSGSVAAQK
LIFGHSLAGNLQPYLSAYFDTHVGHKQEQQSYKNIAKQLKEDPKQILFLT
DIPGEAAAARCAGLQAIILKRPGNAALADDQKTGFELIPDFKPLHNLKVP
VNKSQA*

IP01034.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16066-PA 252 GF16066-PA 1..250 1..250 1005 74.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11122-PA 256 GG11122-PA 1..256 1..256 1223 89.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22720-PA 245 GH22720-PA 1..240 1..241 775 60.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12173-PA 256 CG12173-PA 1..256 1..256 1314 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10215-PA 249 GI10215-PA 1..249 1..250 820 61.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22195-PA 252 GL22195-PA 1..251 1..250 951 74.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11453-PA 252 GA11453-PA 1..251 1..250 945 73.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10653-PA 256 GM10653-PA 1..256 1..256 1258 92.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19634-PA 256 GD19634-PA 1..256 1..256 1256 92.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11016-PA 249 GJ11016-PA 1..249 1..250 841 64 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14286-PA 247 GK14286-PA 7..243 9..244 873 68.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25301-PA 256 GE25301-PA 1..256 1..256 1191 86.3 Plus