Clone IP01047 Report

Search the DGRC for IP01047

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:10
Well:47
Vector:pOT2
Associated Gene/Transcriptsv-RD
Protein status:IP01047.pep: validated not full length
Preliminary Size:4677
Sequenced Size:920

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11049 2005-01-01 Successful iPCR screen
sv 2008-04-29 Release 5.5 accounting
sv 2008-04-29 Picked prior to 5.5
sv 2008-08-15 Release 5.9 accounting
sv 2008-12-18 5.12 accounting

Clone Sequence Records

IP01047.complete Sequence

920 bp (920 high quality bases) assembled on 2005-08-25

GenBank Submission: BT022204

> IP01047.complete
TACCTTCAAGATCCACCTGGAAATCGTGTTGCTTCGTGGATTTTTAGCCA
ACAGGTGGTTCGCGCTGTCTTTTTTACCTTTCAAGGCTTAGATTCCTTGA
CTCAGTGATGTTGTTAGTGTATAAATTCGTATTTGAACGTTTTCACTACC
TTAACTGAGTGACGCTAAATAACTAATAATTTATTGAAATTCTTTAAAAC
AATTATATGTTAACCAATCTTTATAAAACGAAAATATTCAGAACTTATAC
ATTTTGTTGAATCTTTGATGCTTATAATGGATATACAGACATCGACACAT
CATATCCATGGGCTCGGAACACATGAGCTCCAACATCGTATTTTACATCC
ACACATTCTACATTCAACTCAAGAAGAAACCCTTAATACAAGTACAGGCC
AGCTAGAGCACGATTCCCAACATCTGCAACAACATCACCTCACTCATCAT
CAGCAACAGGACGTTTCACCGACTTTGCACAATTTACAAAACACCCGCAC
TGGTGATAGCCTGAGCACTACTATTAATACAAATCAAAATCAACATGGTC
ATCAACATCTTTCCGGAAGTAACATGTATACCTCGTCTCAAATGGAAGAT
AAGTCAAAAGCGAACAAGTATGATGAGTATTCAAGCCGGACACTGAGCAA
CATTTCGGATGCCAATACGACGCCATCTGCAAACAATTTCATAACACAAT
CCCAAGGAATAGAGTGGATAACAGCCATGAATGATATTCAAAACGGGGCA
GAAGACTCACACAGTTCGCAGGGCAGTATTTCGGGTGATGGTAAGATATT
TCTATAGATATACATATATGTATACTTACTAGTAACGTGTGACCTATCTC
CTACCTAATCATTCACACTGATTTTCGCATCAGTAAAGATTTCTCACAAA
GCTAAAAAAAAAAAAAAAAA

IP01047.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
sv.c 2106 sv.c 9..797 4..792 3945 100 Plus
sv-RE 4690 sv-RE 9..797 4..792 3945 100 Plus
sv-RH 4714 sv-RH 56..844 4..792 3945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 1112743..1113112 241..610 1850 100 Plus
chr4 1351717 chr4 1109311..1109548 4..241 1190 100 Plus
chr4 1351717 chr4 1116275..1116429 749..903 775 100 Plus
chr4 1351717 chr4 1116058..1116200 609..751 715 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:30:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 1092259..1092628 241..610 1850 100 Plus
4 1348131 4 1088826..1089063 4..241 1190 100 Plus
4 1348131 4 1095791..1095946 749..904 780 100 Plus
4 1348131 4 1095574..1095716 609..751 715 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 1092259..1092628 241..610 1850 100 Plus
4 1331231 4 1088826..1089063 4..241 1190 100 Plus
4 1331231 4 1095791..1095946 749..904 780 100 Plus
4 1331231 4 1095574..1095716 609..751 715 100 Plus
Blast to na_te.dros performed 2019-03-16 03:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1486..1582 368..461 126 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2319..2386 389..461 110 65.8 Plus
Dbuz\Kepler 722 Dbuz\Kepler KEPLER 722bp 426..456 824..794 110 83.9 Minus

IP01047.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:52:23 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 1109307..1109547 1..240 99 -> Plus
chr4 1112743..1113112 241..610 100 -> Plus
chr4 1116060..1116200 611..751 100 -> Plus
chr4 1116278..1116429 752..903 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:14:01 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
sv-RD 1..525 268..792 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:53:54 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
sv-RD 1..525 268..792 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:06:06 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
sv-RF 1..525 268..792 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:34:37 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
sv-RD 1..525 268..792 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:06 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
sv-RF 1..525 268..792 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:29:12 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
sv-RD 5..797 1..792 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:53:54 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
sv-RD 5..797 1..792 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:06:06 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
sv-RD 25..817 1..792 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:34:37 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
sv-RD 5..797 1..792 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:06 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
sv-RD 25..817 1..792 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:23 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
4 1095576..1095716 611..751 100 -> Plus
4 1095794..1095945 752..903 100   Plus
4 1088822..1089062 1..240 99 -> Plus
4 1092259..1092628 241..610 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:23 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
4 1095576..1095716 611..751 100 -> Plus
4 1095794..1095945 752..903 100   Plus
4 1088822..1089062 1..240 99 -> Plus
4 1092259..1092628 241..610 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:23 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
4 1095576..1095716 611..751 100 -> Plus
4 1095794..1095945 752..903 100   Plus
4 1088822..1089062 1..240 99 -> Plus
4 1092259..1092628 241..610 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:06:06 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 1116202..1116342 611..751 100 -> Plus
arm_4 1116420..1116571 752..903 100   Plus
arm_4 1109448..1109688 1..240 99 -> Plus
arm_4 1112885..1113254 241..610 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:13:11 Download gff for IP01047.complete
Subject Subject Range Query Range Percent Splice Strand
4 1088822..1089062 1..240 99 -> Plus
4 1092259..1092628 241..610 100 -> Plus
4 1095576..1095716 611..751 100 -> Plus
4 1095794..1095945 752..903 100   Plus

IP01047.pep Sequence

Translation from 267 to 806

> IP01047.pep
MLIMDIQTSTHHIHGLGTHELQHRILHPHILHSTQEETLNTSTGQLEHDS
QHLQQHHLTHHQQQDVSPTLHNLQNTRTGDSLSTTINTNQNQHGHQHLSG
SNMYTSSQMEDKSKANKYDEYSSRTLSNISDANTTPSANNFITQSQGIEW
ITAMNDIQNGAEDSHSSQGSISGDGKIFL*

IP01047.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20618-PA 554 GF20618-PA 1..159 4..175 336 48 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16406-PA 842 GG16406-PA 1..174 4..175 670 83.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23966-PA 862 GH23966-PA 1..179 4..175 238 38.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
sv-PG 628 CG11049-PG 1..175 1..175 931 100 Plus
sv-PC 647 CG11049-PC 1..175 1..175 931 100 Plus
sv-PD 680 CG11049-PD 1..175 1..175 931 100 Plus
sv-PF 792 CG11049-PF 1..175 1..175 931 100 Plus
sv-PH 842 CG11049-PH 1..175 1..175 931 100 Plus
sv-PA 844 CG11049-PA 1..175 1..175 931 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14046-PA 965 GI14046-PA 101..226 60..175 230 46 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18401-PA 871 GL18401-PA 1..183 1..175 431 57.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\spa-sv-PA 807 GA27911-PA 1..183 1..175 429 57.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13025-PA 839 GM13025-PA 1..175 1..175 769 93.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24421-PA 680 GD24421-PA 1..175 1..175 754 92 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13730-PA 863 GJ13730-PA 1..168 1..175 202 43.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13586-PA 935 GK13586-PA 65..181 66..174 267 50.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14566-PA 847 GE14566-PA 1..177 1..175 699 81.4 Plus

IP01047.hyp Sequence

Translation from 267 to 806

> IP01047.hyp
MLIMDIQTSTHHIHGLGTHELQHRILHPHILHSTQEETLNTSTGQLEHDS
QHLQQHHLTHHQQQDVSPTLHNLQNTRTGDSLSTTINTNQNQHGHQHLSG
SNMYTSSQMEDKSKANKYDEYSSRTLSNISDANTTPSANNFITQSQGIEW
ITAMNDIQNGAEDSHSSQGSISGDGKIFL*

IP01047.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
sv-PG 628 CG11049-PG 1..175 1..175 931 100 Plus
sv-PC 647 CG11049-PC 1..175 1..175 931 100 Plus
sv-PD 680 CG11049-PD 1..175 1..175 931 100 Plus
sv-PF 792 CG11049-PF 1..175 1..175 931 100 Plus
sv-PH 842 CG11049-PH 1..175 1..175 931 100 Plus