Clone IP01061 Report

Search the DGRC for IP01061

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:10
Well:61
Vector:pOT2
Associated Gene/TranscriptCG4461-RA
Protein status:IP01061.pep: gold
Preliminary Size:2100
Sequenced Size:862

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4461 2005-01-01 Successful iPCR screen
CG4461 2008-04-29 Release 5.5 accounting
CG4461 2008-08-15 Release 5.9 accounting
CG4461 2008-12-18 5.12 accounting

Clone Sequence Records

IP01061.complete Sequence

862 bp (862 high quality bases) assembled on 2004-10-25

GenBank Submission: BT023400

> IP01061.complete
CAGATAAGCGAATCGCTGCCCTAATCCCGGCGAGAAATGTCTCTGGTGCC
TACCACATATCGCGATTTGTCGCGCGAATTTGATCGACTCCGTCCGCTCT
ACCATCCGCCGTATGATTTCCAGCTATATCCGTATCTGTGGGACGATTCG
CGTCTCTGGTGGCCATCGCCTCACACCAGCAGAAGTGACCTACTCCGACC
TCTGGATGAGCTGGTGTCGCGTCGAGTGCGCAACCAGTTGATCCAATCGA
CGCCGTATGAGTGGGCGCATCCAATGAGGTGGGACAACTACTATTCCGGT
GAGCGTGTCCATGTGGATGAGAAGGGATTTCGGATTGACATCGATGTGCG
ACAATTTCATCCCCACGACATTGTGGTCAAAACCAATGACGACTATGTCA
TCGTCCAGGGAAATCACAATCGTCGCGACGAGGGTTCCAATGGCCTGGTG
GAGCGGCACTTTGTGAGGAAGTACCTTCTGCCCCGCGGATACAATGCCAA
TGAGGTAATCTCGGACATATCCAGCGATGGCATCCTCACCATCAAGGCTC
CACCACCGCCGCCAGCCAAGTACTACACGCCCGGAGAGAGATTGGTCCGC
GTTCATGAAACCGGAAAGCTGGCCCTGCCCTGGAAATAGTGGACCATGTG
TCAAAAATCAGGAAGGCAAACAGTGAATGTGTTTTTACCAAACCCAAATC
CCAACCATCGAATGCGCCTAACTCAAGGTGAACTATTTTCGGACACCAAG
CAATTGCAGCCGAACATTTAAATTGGATTCAAACATAAATAAAATACAAA
TTGTACCCGTAGTTGATATAATAAATGCGCAATAAATATTTGGTAGAAAA
AAAAAAAAAAAA

IP01061.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG4461-RA 865 CG4461-RA 23..865 4..846 4215 100 Plus
CG4461.a 802 CG4461.a 365..802 409..846 2190 100 Plus
CG4461.a 802 CG4461.a 23..365 4..346 1715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9367339..9368181 4..846 4110 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:30:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9375451..9376296 4..849 4230 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9368551..9369396 4..849 4230 100 Plus
Blast to na_te.dros performed 2019-03-15 12:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dkoe\Gandalf 979 Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). 793..846 821..764 109 70.7 Minus

IP01061.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:42:04 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9367336..9368181 1..846 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:14:04 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
CG4461-RA 1..603 37..639 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:28:19 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
CG4461-RA 1..603 37..639 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:48:20 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
CG4461-RA 1..603 37..639 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:12:15 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
CG4461-RA 1..603 37..639 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:07:28 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
CG4461-RA 1..603 37..639 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:31:49 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
CG4461-RA 20..841 1..822 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:28:18 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
CG4461-RA 19..864 1..846 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:48:20 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
CG4461-RA 19..864 1..846 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:12:16 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
CG4461-RA 20..841 1..822 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:07:28 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
CG4461-RA 19..864 1..846 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:42:04 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9375448..9376293 1..846 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:42:04 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9375448..9376293 1..846 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:42:04 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9375448..9376293 1..846 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:48:20 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9368548..9369393 1..846 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:48:56 Download gff for IP01061.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9368548..9369393 1..846 99   Plus

IP01061.hyp Sequence

Translation from 36 to 638

> IP01061.hyp
MSLVPTTYRDLSREFDRLRPLYHPPYDFQLYPYLWDDSRLWWPSPHTSRS
DLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRI
DIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPR
GYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVRVHETGKLALPWK
*

IP01061.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG4461-PA 200 CG4461-PA 1..200 1..200 1105 100 Plus
Hsp27-PB 213 CG4466-PB 85..190 93..200 283 48.1 Plus
Hsp27-PA 213 CG4466-PA 85..190 93..200 283 48.1 Plus
Hsp67Ba-PA 445 CG4167-PA 122..204 93..176 250 50 Plus
Hsp23-PB 186 CG4463-PB 60..164 87..193 241 44.9 Plus

IP01061.pep Sequence

Translation from 36 to 638

> IP01061.pep
MSLVPTTYRDLSREFDRLRPLYHPPYDFQLYPYLWDDSRLWWPSPHTSRS
DLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRI
DIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPR
GYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVRVHETGKLALPWK
*

IP01061.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10690-PA 199 GF10690-PA 1..199 1..200 882 90.5 Plus
Dana\GF10692-PA 219 GF10692-PA 90..195 93..200 241 48.1 Plus
Dana\GF10691-PA 190 GF10691-PA 66..164 93..193 230 43.6 Plus
Dana\GF11829-PA 187 GF11829-PA 68..171 87..193 225 42.7 Plus
Dana\GF10323-PA 155 GF10323-PA 50..147 89..193 218 43.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15369-PA 200 GG15369-PA 1..200 1..200 1023 98 Plus
Dere\GG14046-PA 445 GG14046-PA 121..203 93..176 255 50 Plus
Dere\GG15371-PA 212 GG15371-PA 1..191 1..200 247 34.6 Plus
Dere\GG15370-PA 187 GG15370-PA 67..172 93..200 246 46.3 Plus
Dere\GG20009-PA 187 GG20009-PA 68..171 87..193 224 43.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14558-PA 201 GH14558-PA 1..201 1..200 783 76.4 Plus
Dgri\GH17009-PA 218 GH17009-PA 89..194 93..200 276 50 Plus
Dgri\GH15298-PA 155 GH15298-PA 50..147 89..193 227 45.7 Plus
Dgri\GH21555-PA 189 GH21555-PA 1..173 1..193 224 34.8 Plus
Dgri\GH14557-PA 171 GH14557-PA 21..146 71..197 223 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG4461-PA 200 CG4461-PA 1..200 1..200 1105 100 Plus
Hsp27-PB 213 CG4466-PB 85..190 93..200 283 48.1 Plus
Hsp27-PA 213 CG4466-PA 85..190 93..200 283 48.1 Plus
Hsp67Ba-PA 445 CG4167-PA 122..204 93..176 250 50 Plus
Hsp23-PB 186 CG4463-PB 60..164 87..193 241 44.9 Plus
Hsp23-PA 186 CG4463-PA 60..164 87..193 241 44.9 Plus
l(2)efl-PC 187 CG4533-PC 1..171 1..193 227 35.1 Plus
l(2)efl-PA 187 CG4533-PA 1..171 1..193 227 35.1 Plus
CG7409-PA 154 CG7409-PA 50..146 90..193 225 45.2 Plus
Hsp26-PB 208 CG4183-PB 83..182 92..193 221 40.2 Plus
Hsp26-PA 208 CG4183-PA 83..182 92..193 221 40.2 Plus
Hsp22-PB 174 CG4460-PB 39..160 73..196 198 34.4 Plus
Hsp22-PA 174 CG4460-PA 39..160 73..196 198 34.4 Plus
Hsp67Bc-PA 199 CG4190-PA 81..155 98..173 169 38.2 Plus
CG14207-PC 154 CG14207-PC 62..151 94..189 161 36.5 Plus
CG14207-PD 183 CG14207-PD 91..180 94..189 161 36.5 Plus
CG14207-PA 183 CG14207-PA 91..180 94..189 161 36.5 Plus
CG14207-PB 192 CG14207-PB 100..189 94..189 161 36.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12245-PA 198 GI12245-PA 1..198 1..200 905 86.5 Plus
Dmoj\GI13087-PA 209 GI13087-PA 83..187 93..200 271 47.2 Plus
Dmoj\GI12247-PA 211 GI12247-PA 61..193 59..200 236 35.9 Plus
Dmoj\GI19527-PA 189 GI19527-PA 1..173 1..193 229 34.7 Plus
Dmoj\GI12009-PA 155 GI12009-PA 50..147 89..193 227 44.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22442-PA 200 GL22442-PA 1..200 1..200 891 88 Plus
Dper\GL22447-PA 225 GL22447-PA 93..198 93..200 234 46.3 Plus
Dper\GL22445-PA 225 GL22445-PA 93..198 93..200 234 46.3 Plus
Dper\GL22446-PA 184 GL22446-PA 60..171 87..200 233 42.1 Plus
Dper\GL22443-PA 184 GL22443-PA 60..171 87..200 233 42.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18200-PA 200 GA18200-PA 1..200 1..200 891 88 Plus
Dpse\GA18205-PA 225 GA18205-PA 93..198 93..200 234 46.3 Plus
Dpse\GA28726-PA 144 GA28726-PA 12..117 93..200 230 45.4 Plus
Dpse\GA18202-PA 184 GA18202-PA 60..171 87..200 230 42.1 Plus
Dpse\GA20330-PA 154 GA20330-PA 49..153 89..200 225 43.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25141-PA 200 GM25141-PA 1..200 1..200 1026 98.5 Plus
Dsec\GM24880-PA 403 GM24880-PA 122..204 93..176 256 51.2 Plus
Dsec\GM25143-PA 213 GM25143-PA 85..190 93..200 245 47.2 Plus
Dsec\GM25142-PA 183 GM25142-PA 57..168 87..200 244 44.7 Plus
Dsec\GM15521-PA 187 GM15521-PA 1..171 1..193 227 35.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14175-PA 200 GD14175-PA 1..200 1..200 1026 98.5 Plus
Dsim\GD12932-PA 391 GD12932-PA 68..150 93..176 258 51.2 Plus
Dsim\GD14177-PA 213 GD14177-PA 85..190 93..200 245 47.2 Plus
Dsim\GD25025-PA 187 GD25025-PA 1..171 1..193 227 35.1 Plus
Dsim\GD14033-PA 154 GD14033-PA 49..146 89..193 219 44.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11477-PA 199 GJ11477-PA 1..199 1..200 891 84.6 Plus
Dvir\GJ13835-PA 211 GJ13835-PA 84..189 93..200 266 47.2 Plus
Dvir\GJ11479-PA 216 GJ11479-PA 10..185 15..193 229 32.6 Plus
Dvir\GJ13836-PA 214 GJ13836-PA 55..184 55..193 229 35.3 Plus
Dvir\GJ21096-PA 189 GJ21096-PA 70..173 87..193 227 42.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19289-PA 199 GK19289-PA 1..199 1..200 815 85.7 Plus
Dwil\GK17637-PA 227 GK17637-PA 93..198 93..200 238 46.3 Plus
Dwil\GK16565-PA 471 GK16565-PA 136..234 93..192 233 45 Plus
Dwil\GK23172-PA 187 GK23172-PA 68..171 87..193 222 42.7 Plus
Dwil\GK21206-PA 155 GK21206-PA 50..147 89..193 218 43.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20831-PA 200 GE20831-PA 1..200 1..200 1026 98.5 Plus
Dyak\GE20833-PA 212 GE20833-PA 1..191 1..200 251 35.1 Plus
Dyak\GE20832-PA 186 GE20832-PA 66..164 93..193 244 46.5 Plus
Dyak\GE11545-PA 187 GE11545-PA 68..171 87..193 225 43.2 Plus
Dyak\GE21638-PA 154 GE21638-PA 49..146 89..193 219 44.8 Plus