Clone IP01109 Report

Search the DGRC for IP01109

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:11
Well:9
Vector:pOT2
Associated Gene/TranscriptTfIIEbeta-RA
Protein status:IP01109.pep: gold
Preliminary Size:1052
Sequenced Size:1022

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1276 2005-01-01 Successful iPCR screen
TfIIEbeta 2008-04-29 Release 5.5 accounting
TfIIEbeta 2008-08-15 Release 5.9 accounting
TfIIEbeta 2008-12-18 5.12 accounting

Clone Sequence Records

IP01109.complete Sequence

1022 bp (1022 high quality bases) assembled on 2005-08-25

GenBank Submission: BT022197

> IP01109.complete
ATTGTTGATTTCTCGCAGCAGAAAGTTTTTTTTCGTAGAGCTAAATAATA
AAAAAAAACATTCGAAATGGATCCAGCACTGCTTCGCGAACGCGAGGCCT
TCAAAAAGCGGGCGATGGCCACGCCCACCGTGGAAAAGAAGTCCAAGCCC
GATAGACCAGCTCCACCGCCGCCTAGCGATGATTCCAGGCGCAAAATGCG
CCCGCCCAATGCTCCCAGGCTGGATGCCACAACATACAAGACCATGTCCG
GCAGTTCCCAGTACCGCTTTGGAGTGCTGGCCAAGATTGTGAAATTCATG
CGCACACGTCACCAGGACGGCGACGACCATCCCCTGACCATCGATGAGAT
TCTGGACGAGACCAACCAGCTGGACATTGGGCAATCCGTTAAGAATTGGC
TTGCTAGCGAGGCTCTGCACAACAATCCCAAGGTGGAAGCCAGTCCATGT
GGCACCAAGTTCAGTTTCAAGCCAGTCTACAAGATCAAGGATGGCAAAAC
GCTGATGCGTCTGCTCAAGCAACATGATTTAAAGGGCCTGGGCGGCATTT
TGCTGGACGATGTCCAGGAATCTCTACCACACTGCGAAAAGGTGCTGAAG
AACCGATCAGCCGAAATACTTTTTGTTGTTAGACCCATTGACAAAAAGAA
GATTTTATTTTACAATGACAGGACTGCTAATTTTTCGGTGGACGACGAGT
TCCAGAAGCTATGGCGCTCGGCTACGGTCGATGCAATGGACGACGCCAAG
ATTGACGAGTACCTCGAGAAGCAGGGCATTCGCTCCATGCAGGACCATGG
CCTCAAGAAAGCAATTCCCAAGCGCAAGAAGGCGGCCAACAAGAAGCGGC
AGTTCAAGAAGCCCAGAGACAACGAACATTTGGCCGACGTTCTGGAGGTC
TACGAGGATAACACACTAACGCTGAAGGGTGTGAACCCAACGTAGAATAG
AGACATTAGATTATACAAATAAAAACCACTCTCAATGGAATTAAGTACAC
TCGAAAAAAAAAAAAAAAAAAA

IP01109.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIEbeta-RA 1213 TfIIEbeta-RA 58..1063 1..1006 5030 100 Plus
TfIIEbeta-RB 1132 TfIIEbeta-RB 247..1124 129..1006 4390 100 Plus
TfIIEbeta-RB 1132 TfIIEbeta-RB 47..174 1..128 640 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4287419..4287735 687..1003 1585 100 Plus
chr3L 24539361 chr3L 4287073..4287367 397..691 1475 100 Plus
chr3L 24539361 chr3L 4286850..4287012 234..396 815 100 Plus
chr3L 24539361 chr3L 4286470..4286597 1..128 640 100 Plus
chr3L 24539361 chr3L 4286670..4286774 129..233 525 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:30:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4288033..4288352 687..1006 1600 100 Plus
3L 28110227 3L 4287687..4287981 397..691 1475 100 Plus
3L 28110227 3L 4287464..4287626 234..396 815 100 Plus
3L 28110227 3L 4287084..4287211 1..128 640 100 Plus
3L 28110227 3L 4287284..4287388 129..233 525 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4288033..4288352 687..1006 1600 100 Plus
3L 28103327 3L 4287687..4287981 397..691 1475 100 Plus
3L 28103327 3L 4287464..4287626 234..396 815 100 Plus
3L 28103327 3L 4287084..4287211 1..128 640 100 Plus
3L 28103327 3L 4287284..4287388 129..233 525 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:52:20 has no hits.

IP01109.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:53:02 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4286850..4287012 234..396 100 -> Plus
chr3L 4287073..4287363 397..687 100 -> Plus
chr3L 4287420..4287735 688..1003 100   Plus
chr3L 4286470..4286597 1..128 100 -> Plus
chr3L 4286670..4286774 129..233 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:14:08 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIEbeta-RA 1..879 67..945 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:52:41 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIEbeta-RA 1..879 67..945 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:01:48 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIEbeta-RA 1..879 67..945 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:33:26 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIEbeta-RA 1..879 67..945 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:34:17 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIEbeta-RA 1..879 67..945 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:27:21 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIEbeta-RA 47..1049 1..1003 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:52:41 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIEbeta-RA 47..1049 1..1003 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:01:48 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIEbeta-RA 47..1049 1..1003 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:47 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIEbeta-RA 47..1049 1..1003 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:34:17 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIEbeta-RA 47..1049 1..1003 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:53:02 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4287084..4287211 1..128 100 -> Plus
3L 4287284..4287388 129..233 100 -> Plus
3L 4287464..4287626 234..396 100 -> Plus
3L 4287687..4287977 397..687 100 -> Plus
3L 4288034..4288349 688..1003 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:53:02 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4287084..4287211 1..128 100 -> Plus
3L 4287284..4287388 129..233 100 -> Plus
3L 4287464..4287626 234..396 100 -> Plus
3L 4287687..4287977 397..687 100 -> Plus
3L 4288034..4288349 688..1003 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:53:02 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4287084..4287211 1..128 100 -> Plus
3L 4287284..4287388 129..233 100 -> Plus
3L 4287464..4287626 234..396 100 -> Plus
3L 4287687..4287977 397..687 100 -> Plus
3L 4288034..4288349 688..1003 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:01:48 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4287084..4287211 1..128 100 -> Plus
arm_3L 4287284..4287388 129..233 100 -> Plus
arm_3L 4287464..4287626 234..396 100 -> Plus
arm_3L 4287687..4287977 397..687 100 -> Plus
arm_3L 4288034..4288349 688..1003 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:11:58 Download gff for IP01109.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4287687..4287977 397..687 100 -> Plus
3L 4288034..4288349 688..1003 100   Plus
3L 4287084..4287211 1..128 100 -> Plus
3L 4287284..4287388 129..233 100 -> Plus
3L 4287464..4287626 234..396 100 -> Plus

IP01109.hyp Sequence

Translation from 66 to 944

> IP01109.hyp
MDPALLREREAFKKRAMATPTVEKKSKPDRPAPPPPSDDSRRKMRPPNAP
RLDATTYKTMSGSSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETN
QLDIGQSVKNWLASEALHNNPKVEASPCGTKFSFKPVYKIKDGKTLMRLL
KQHDLKGLGGILLDDVQESLPHCEKVLKNRSAEILFVVRPIDKKKILFYN
DRTANFSVDDEFQKLWRSATVDAMDDAKIDEYLEKQGIRSMQDHGLKKAI
PKRKKAANKKRQFKKPRDNEHLADVLEVYEDNTLTLKGVNPT*

IP01109.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIEbeta-PA 292 CG1276-PA 1..292 1..292 1525 100 Plus
TfIIEbeta-PB 249 CG1276-PB 1..249 44..292 1300 100 Plus

IP01109.pep Sequence

Translation from 66 to 944

> IP01109.pep
MDPALLREREAFKKRAMATPTVEKKSKPDRPAPPPPSDDSRRKMRPPNAP
RLDATTYKTMSGSSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETN
QLDIGQSVKNWLASEALHNNPKVEASPCGTKFSFKPVYKIKDGKTLMRLL
KQHDLKGLGGILLDDVQESLPHCEKVLKNRSAEILFVVRPIDKKKILFYN
DRTANFSVDDEFQKLWRSATVDAMDDAKIDEYLEKQGIRSMQDHGLKKAI
PKRKKAANKKRQFKKPRDNEHLADVLEVYEDNTLTLKGVNPT*

IP01109.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25060-PA 292 GF25060-PA 1..292 1..292 1371 89.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15217-PA 292 GG15217-PA 1..292 1..292 1513 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15942-PA 292 GH15942-PA 1..292 1..292 1365 88.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIEbeta-PA 292 CG1276-PA 1..292 1..292 1525 100 Plus
TfIIEbeta-PB 249 CG1276-PB 1..249 44..292 1300 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16593-PA 292 GI16593-PA 1..292 1..292 1360 89.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17873-PA 292 GL17873-PA 1..292 1..292 1407 91.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11796-PA 292 GA11796-PA 1..292 1..292 1339 92.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14648-PA 292 GM14648-PA 1..292 1..292 1545 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13833-PA 292 GD13833-PA 1..292 1..292 1536 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12845-PA 292 GJ12845-PA 1..292 1..292 1352 88.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10558-PA 292 GK10558-PA 1..292 1..292 1333 88 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21436-PA 292 GE21436-PA 1..292 1..292 1513 96.6 Plus